SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021014 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021014
Domain Number 1 Region: 812-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.0012
Further Details:      
 
Domain Number 2 Region: 268-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 427-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000234
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 4 Region: 919-961
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 5 Region: 868-916
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000977
Family Laminin-type module 0.00093
Further Details:      
 
Domain Number 6 Region: 324-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000391
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 7 Region: 714-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 8 Region: 380-429
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 9 Region: 967-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 10 Region: 757-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000363
Family Laminin-type module 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021014
Domain Number - Region: 672-711
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000131
Family EGF-type module 0.078
Further Details:      
 
Domain Number - Region: 74-157
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0051
Family Galactose-binding domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021014   Gene: ENSGACG00000015920   Transcript: ENSGACT00000021054
Sequence length 1590
Comment pep:known_by_projection group:BROADS1:groupXIV:2455208:2525326:1 gene:ENSGACG00000015920 transcript:ENSGACT00000021054 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVLPSLLLSLHLHCSLLAWAAMDSCIDEEGGPSRCMPKFENVAFNRTVVTSNVCGSPPED
YCMQTGSTRSCRHCDASHPDLSHGAGLLTDFHRNEEPTWWQSQSMYYGVQHPSSVNLTLH
LGKAFEITYVRLKFYTSRPESFAIYKRTAEGGSWVPYQFYSASCRKTYGKDAKAYIRPGD
DERTALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDQSAVLKEWVTATDLLISLDRLNT
FGDEFFKDAKVLRSYFYAISDFSVGGRCKCNGHASECVASEHRGLVCSCQHHTAGDDCQR
CQPFYQDRPWFRATGDSANECLKCNCSGRSDECVFDAEQYRSTGSGGRCVSCRDNTDGPH
CERCRQDHYRASAEEPCLPCNCNVNGSVSLQCDGEGRCACSAGVTGEKCDACRAGFHSLG
HGGCRPCECDPGGSVDDCSPLDGHCPCKPNVEGQSCDRCKPGFFNLEPVNPAGCQACFCS
GHSLACSSSHRYAAASITSDFLEDQDGWLGEFSGGQQYTLLWKEGEVYLLPLTEEDVGFY
KAPEKFLGQQVYSYGQLLSITFTSETPELLPHRVTLLLQGAGVTLSLSHSAFLSPMISSH
PRRSGLNYRLHENEMRFQPPLSASAFQQLLNNLTALRISNAGGHNYTSQLAGVTLTSALV
PSGAAHPPAPWVESCSCPPAFTGQFCERCAPGFTREDSARGPLSTCVPCNCHQHGTCHPE
TGACECSDFTAGMTCERCRAGYHGNAVTGTPGDCRPCPCPGRTSCAEIAKTGQVVCTNCP
AGQTGMRCQMCEDGYYGDPLGQSGEARACARCDCSGNVDFNALGTCDRVTGECLKCLGHT
EGDRCQRCQRGFYGDARSQSAGQKCKPCSCNPKGTSGRVNECHPQTGECQCLGHVTGRDC
SSCDGGFFNLQPGVGCERCKCNPIGSASAACHPSTGQCVCRAGVEGVLCDSCRVGFFGFS
SRGCRACNCDPMGSVSMQCHGNGTCHCRQGFVGYKCDKCEMNYFHSSATHQCEECPVCYG
LVKKQAEQMRTRLQDLEKLLAHFDCRGRSGKRHPLLKYPMARLHEHGDQGEDALPKAREA
FIKHFSLLEASHGTLLAQLHGITSTLNCSISGACQTFTQTAFMVTASQEQLKQATRDLDN
MIIPFEVPSEPNKWNILVNDSRALMKSHGETADHIEAVASRAARVSQQTLGLLADLLQEI
TRMRRQRADLTSRVNDAAAEQLALEEEAAGLKLALGNITSSLHQMSPSSSPYLTIGKQRG
TLRRRSREDPSRIGCSWGSPQRKQNGISSFGVEAWCICASCLVGGGPAKTKRRAGPANSD
ERQAHQMQADAEGAKVAALSSVVTGKEVESDAIALHRELQYMVREFPRRRTQTEAAVKKG
RPLEEKVLADVRKKVSQIEKMLKPALENSSLSSNATKEAERRAHAVAKESKAILTQAKHT
RTASAHLDSHIDSALKQLAEQETLADTLSSQITSEPEASLAGVMEDMEAAKLQLKAYSAT
LTELISSIDGNVPLERFHRLLDETARRLSVLRGSVDSPALVSKIQRLQSAAKEQHSRMSF
IEQDLQEIREERDSLRDIALNLPQSCPRAT
Download sequence
Identical sequences G3PTS7
ENSGACP00000021014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]