SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021282 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021282
Domain Number 1 Region: 809-980
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0037
Further Details:      
 
Domain Number 2 Region: 955-1075
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.31e-30
Family Ypt/Rab-GAP domain of gyp1p 0.0063
Further Details:      
 
Domain Number 3 Region: 158-179,261-372
Classification Level Classification E-value
Superfamily PH domain-like 1.64e-27
Family Phosphotyrosine-binding domain (PTB) 0.0085
Further Details:      
 
Domain Number 4 Region: 1-141
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000105
Family Phosphotyrosine-binding domain (PTB) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021282   Gene: ENSGACG00000016125   Transcript: ENSGACT00000021323
Sequence length 1177
Comment pep:known_by_projection group:BROADS1:groupIX:1575883:1609579:1 gene:ENSGACG00000016125 transcript:ENSGACT00000021323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YRLTLIGSLPVHHLTTMAMLPWVVAEISRCAQRSAGPVPHSGGPSGPSSLNQSVFLCVSA
SRVRCVCVLAEGGGWDPLTRTVLFECRPHQVTKLIHNSQEPGGFGCLVREGASCTCYVFR
GQDSTKVPEIISTLRQAGKSSARSDVTSAVISPTAFAKKFEVLFCGRASVAHKKAPPALI
DECIEKFGQLHGSGASEEGATARGSAGAPQRASFQPNGLGGADVRNGAAGSPTAGKRPAL
FKGDPSFPCLQALDENGLSPEISHTNTTEAHSAGVQPTSLQENRTMLFMVGRSQIFLVSP
DTKKVAIEKSFREISFCSQGIRHVDHFGFICRETVEGGSCHFVCYVFQCTDESLVDEIML
TLKQAFSVAAVQQNMKNQRQQCDSCPMQQLHRLCERIEGLHASKTKLELQRHLATLDNEE
QASVFENTMRACPKSDQEENELVMAYLRVLYEEKQRSHQHALPGDIKQSSSRQRLEQFKS
RAKRSLTESLEGIWKGSSKARAQRDNSVGGDGASSVCALDSNQDQSCLDDPLPAPSQLRP
TSPLRLASWNAVFLKYQNIFRPNCFRRRASTFSHPPTPSSADNSPLHALTRTPQDHASAS
KPKLVRHYSVSTDTPHQSNPLVGLRARLRSSSSVPNFLKFPFLAPVQENECSDVPKSSDV
VALSSLSAACGVAESPLRSYRHSWRQQIFLRVATPQKTTDPSALRKVYLYSTDILQLIEE
FPVISYWRGVEDSSMIEERNSSVQLRELWRKAILQQILLQRMEMENQKLQAASESNLQNK
RLKLDYDEITPCLKDVTLVWEKMLGTPARAKVKFDTEAIHGAVAQGVPRQHRGEIWKLLS
EQYLLRQTVPSRPPANPTPYKELLKQLTTQQHAILIDLGRTFPTHPYFQGQLGAGQLSLY
NLLKAYSLLDPEVGYCQGLSFIAGVLLLHMGEEDAFYMLKFLMYDVGLRKQYRPDMIILQ
IQMYQLSRLLHDYHRDLYVHLEQQEIGPSLYATPWFLTAFASHFPLGFVARVFDMLFLQG
SEVIFKVAMSLLGSHKPLILQHESLESIVDFIKTTLPNLGLVQMEKTINQVCQMDVSKQL
QAYEVEYHVLQDELVDMPPSLTQQQRAAQLERTNQSLRQQNLDLLEELQVSHARVCSLEG
QVETLAQSEGRLREQVTALEGEKEQLASAVGRLRELL
Download sequence
Identical sequences G3PUJ5
ENSGACP00000021282 ENSGACP00000021282 69293.ENSGACP00000021282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]