SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021641 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021641
Domain Number 1 Region: 150-183
Classification Level Classification E-value
Superfamily WW domain 0.0000000000504
Family WW domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021641   Gene: ENSGACG00000016392   Transcript: ENSGACT00000021682
Sequence length 542
Comment pep:known_by_projection group:BROADS1:groupIII:10274678:10281905:-1 gene:ENSGACG00000016392 transcript:ENSGACT00000021682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPLKEDRQEATVPPHTHTHITTALMVMYARKPTRVSDGCNERRDSQSYQTHKSQPKSQTS
GPNRYDKVRDGSSDPTPPFKMLRRSDESPVSRHGDGPAHGKAKTSQAVRGKNGTSGSPQE
NSHNNSSHPGSDSHATQSKPADRHQEPADDWTEHISSSGKKYYYNCRTEVSQWEKPKDLL
EREQRQKDPVKMAANSFPRDMDYRQEALQDKASTTKAFLSTETTPGDQSAASNSGQSLNS
APGALAGQVPQSVQSPSPALLQDPALLHQLLPALQAALQMNNGNMDMAKLNEVLAAAVTQ
ASLRSVLHKLLAAGPAFNVTALLSAAQHSNQASAQHSSQSPVSLTSDASSPRPYVSPRNG
TPQSSQKSLLAGHPGGVTSSQTRVSGPNKSKQGAAPLSQVPEKRLEDPRTLQQRSSQELL
CTGSSLSGAALAHVPSGSTSNAHVDKPGSFTPTLATHFDESLIRHIQGWPSENIEKQAAR
LREDLHNMGSLYMSEICTEMKNLRSLVRVCEIQATLREQRILFLRQQSKELDKLKNQNSY
MV
Download sequence
Identical sequences G3PVK2
69293.ENSGACP00000021641 ENSGACP00000021641 ENSGACP00000021641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]