SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021696 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021696
Domain Number 1 Region: 290-339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021696   Gene: ENSGACG00000016431   Transcript: ENSGACT00000021737
Sequence length 344
Comment pep:known_by_projection group:BROADS1:groupIV:1324374:1329169:-1 gene:ENSGACG00000016431 transcript:ENSGACT00000021737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMDTAVNVPSASEALYRLVVMTLTLGPCVRSTPVPTDGPTCAASETARYKLTFSGKWTQA
AFPKQYPFYRPPAQWSTLIGVTHSSDYHMWQRDGFASNGVREFAEKGEAWTTVEEVEAAG
ERIQSVYGLLSAPAVGGGTGQTNTEFEVFARHSYLSFMVRLVPSPDWFVGVESVDLCDVD
RWKDNVTLELFPYDAGTDSGFTFSSPNFQTIPQDKITQITSSFPNHPASSFYYPRLKHLP
PIAKVMLTRMNKTNQIFSLPVEPTQSNQLPTGNEIEDTLLPTRLKYTPLDCEVSVWSPWG
LCKSKCGDSGVQHRTRYVVMHSANNGLACPLLEEERKCLPDNCL
Download sequence
Identical sequences G3PVQ7
ENSGACP00000021696 69293.ENSGACP00000021696 ENSGACP00000021696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]