SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021799 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021799
Domain Number 1 Region: 67-276
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.08e-48
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 292-331
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000051
Family SOCS box-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021799   Gene: ENSGACG00000016501   Transcript: ENSGACT00000021840
Sequence length 332
Comment pep:known_by_projection group:BROADS1:groupIV:2023661:2028057:-1 gene:ENSGACG00000016501 transcript:ENSGACT00000021840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSERTEELSNKPFVARLSNVYLSILALFCFKLFVKISLNLLTYFYIVRGNRKEAARISAE
FYDYGQKHGSWADRSPLHDAASQGRLLALKTLISQGHSVNALTIDHVTPLHEACVGDHVA
CARALIDAGANVNAFTIDGVTPLFNACAAGSVACTEILLENGAKPQSFECRPSPIHEATS
KGHYGCVEALVSWGADVDVDIPHLGTALYTACVCQELECARRLLREGASVQKGKSLDSPL
HAAAEKDFTAVVKLLLDFGADINGRNAEFQRPVDVAPPSSLSEGFLLTYEVTPRRLDQLC
RLGIRSCVGRDRLRLLSHLPLPNRLRNYLQFQ
Download sequence
Identical sequences G3PW10
ENSGACP00000021799 ENSGACP00000021799 69293.ENSGACP00000021799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]