SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022514 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022514
Domain Number 1 Region: 291-429
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-38
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 2 Region: 710-852
Classification Level Classification E-value
Superfamily C-type lectin-like 7.17e-32
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 3 Region: 436-562
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-29
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 4 Region: 866-1004
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-28
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 566-713
Classification Level Classification E-value
Superfamily C-type lectin-like 5.91e-27
Family C-type lectin domain 0.0000826
Further Details:      
 
Domain Number 6 Region: 1152-1276
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-26
Family C-type lectin domain 0.00085
Further Details:      
 
Domain Number 7 Region: 166-287
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-26
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 8 Region: 1030-1142
Classification Level Classification E-value
Superfamily C-type lectin-like 8.61e-26
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 9 Region: 94-151
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000999
Family Fibronectin type II module 0.0025
Further Details:      
 
Domain Number 10 Region: 2-94
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000643
Family Cysteine rich domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022514   Gene: ENSGACG00000017045   Transcript: ENSGACT00000022556
Sequence length 1354
Comment pep:known_by_projection group:BROADS1:groupIII:12697544:12708695:1 gene:ENSGACG00000017045 transcript:ENSGACT00000022556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWTTGDRLFVTSTKKCLGAQGRSAGSEVSLYDCDDSSPLQRWECKNETLLALKDQALYV
EVKPDQSISLSRTAGPNNELTVTGTSSGACSRTYRELYTIDGNANGKICAFPFLYKDRWF
ADCTTFDSSIKRLWCAINSKFEYEQWGYCPTSCEYGCTATDHWAKNPVTGAFYQVNTQSA
LTWAQADTSCRQQGAALLSITDPHQQAFVSALMGAGKHKVWIGLVLDPEHGWQWSDRKPF
RYLRWNIGNPAPNPGHSCAFLESAGEQTWQSQSCGKKQGYVCFKSINPIHLLFFPSSVEQ
GFCAAPWIPYNGHCFHLQRVIQTWSDAQKECRKEGGDLVSIRHVEDQSFVISQLGFASAD
ELWIGLNDIKSEGLFDWSDHSTVSFTSWEFGKPSTFADEDDCVLIRGENGNWADRLCSEK
HGFICMKQSSTESTGAEGWKRHGSYCYFVGAETKTFDEAKEDCKSSDSYLVDVSNGVDNA
FLASMVGLRPERYFWLGLSNQKNLDQFVWTNTDSVKFTHWNVDMPGYRQGCVAMTTGILA
GLWDLLPCSNKEKYICKHLAEGAVVTVPPPTQSQPQCEEGWVRMGTRSVCAKLFTGPRSS
EKTWYEARDYCRAIGGELLSIHGIPELHVGNDIVEDPFLYSRFAKAWIGLHIPDVNTGYA
WSDGTPHWQEGEPNNHNNDENCVEFRTYYVNDHGSWNDANCEGYNDWFCQILAGVTPKIP
PKYNRTSDGWLVWRGSQYFISGNPMSMEDARHFCQQRHGDLVSINSKDENTFLWKQVEIS
RHYGAYYIGLSVDLDGSFWWMDGSTVGLQKWEVDQPSTDTFDFNCVVMNYYMGYWRSCNC
GNENQFICKRRISAPVNSTAAPTVAPKGGCPLKWSKFDSKCYSIIFNRRVVWEEARSQCS
SMGGYFASIPTRRVQTFLTTKMSEMATSDLWIGLSALKQDGFYWSDGKSRKFTNWNYSDF
EILNLAHVPPQGECVVVNSNPALGVGKWSIRSCNDTNGFICIRDVGEFILSLSLKINYPS
YVPLGNDSIKFVNGNLTWYDARKHCQGDKSDLASLRNDWTQAYVELLAMKLKVPLWIGLN
KQESGYFRFIDGWQLRSVNWAEGEPSRDRPCVYVDEEGKWRTAFCNRTMNSVCKQSTGIC
PPDMDEDDNPVNNWLPFKGHCYLFITDEIEWANAASNCVRHAFCVAKGGSLASIEDPAEQ
EFIKGHVEVFRDSTSSFWVGLFKTHAAGEWKWLDKTVMEYINWAEDEPENDFGSIGSSDG
LWRTGSRWHDKAYVCKAAKEPHGGQDPRGRVHTSLIVVLVITLVSTLMVVAFFIYKKSPR
TLPTFDNPLYFDRERSQPDVVDTNKLIENAEEEN
Download sequence
Identical sequences G3PY25
69293.ENSGACP00000022514 ENSGACP00000022514 ENSGACP00000022514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]