SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022711 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022711
Domain Number 1 Region: 129-411
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.57e-82
Family Eukaryotic proteases 0.0000188
Further Details:      
 
Domain Number 2 Region: 18-80
Classification Level Classification E-value
Superfamily GLA-domain 1.28e-23
Family GLA-domain 0.00037
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022711
Domain Number - Region: 107-147
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0022
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022711   Gene: ENSGACG00000017195   Transcript: ENSGACT00000022754
Sequence length 425
Comment pep:known_by_projection group:BROADS1:groupIV:5886034:5889741:-1 gene:ENSGACG00000017195 transcript:ENSGACT00000022754 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLSGRAADSVLRRHKRYNRGLFEELLQGNLERECMEEVCDREEAREIFEDDEQTRKFWAT
YRDGDQCESSPCLNEGSCRDHIGYFSCACASGFTGQICEIGRFVAKRCDVNNGDCMHFCT
SMGTSGAKCSCARGYKLLQDGLNCDPHVDFPCGRTALMEVQAEEKPQAFKRIVGGEVAIP
GEIPWQVALIGRPSGELFCGGSILSERWVITAAHCLGEEAGSFFVRVGVGEHDIYINEGT
EQDHEVSERHIYHRYNASVSLYNHDIALLHLRSPIVFSTAVRPICLGPKAFTEALVKESS
PATVSGWGRTRFLGFTAAALQRVEVPYADRIECKQSSSARITPAMFCAGYHEEAKDACQG
DSGGPHANSAHDTWFLTGIVSWGEECAKQGKYGVYTRVSLYYPWINHIMSNSHVKHSGFK
GSPLT
Download sequence
Identical sequences G3PYM1
ENSGACP00000022711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]