SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022765 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022765
Domain Number 1 Region: 4-77
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000157
Family Growth factor receptor domain 0.0057
Further Details:      
 
Domain Number 2 Region: 73-137
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000188
Family Fibronectin type I module 0.063
Further Details:      
 
Domain Number 3 Region: 184-227
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000863
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022765   Gene: ENSGACG00000017235   Transcript: ENSGACT00000022808
Sequence length 326
Comment pep:known_by_projection group:BROADS1:groupIII:13390658:13391837:-1 gene:ENSGACG00000017235 transcript:ENSGACT00000022808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPKDCRCPPGTPRCAAGVRFTLDGCGCCRVCPRQLFEDCNKTLPCDRTKGLECNFGGRSG
SAQGICRAKADGRTCEYSNGIHQNGEIFRPNCKHQCTCMDGAVGCVSLCPHQLRLPKLGC
AEPERVKVRGRCCEQLAKTKCSAKTKHRKTAGRDKLSGDDLANRNELAPAGRGESNNFIG
GVKCVSQTTAWSPCSKSCGTGVSTRTSNRNSQCQLVKETRICEVRPCKKNDSKLKKGPQC
DQPEEASRPAKLSHAGCRSLIKFRLRYCGSGSDGRCCEPHRTQTLPVRFRCKRGEVLTRM
VMVIQSCRCHRNCSGYGLYNDNNKAD
Download sequence
Identical sequences G3PYS5
69293.ENSGACP00000022765 ENSGACP00000022765 ENSGACP00000022765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]