SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022863 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000022863
Domain Number - Region: 182-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.053
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 226-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0712
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 140-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0795
Family EGF-type module 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022863   Gene: ENSGACG00000017313   Transcript: ENSGACT00000022906
Sequence length 554
Comment pep:known_by_projection group:BROADS1:groupII:21709930:21734771:-1 gene:ENSGACG00000017313 transcript:ENSGACT00000022906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALLGLSLLGFVCLASALNPDDPNVCSHWESYAVTVQESYAHPFDQVYYTRCTDILNWFKC
TRHSRISYKTAYRRGVRTMYRRRSQCCPGFYESGNLCVPLCTEECDHGRCVSPDTCQCEP
GWGGLDCSSGCESDFWGPHCSNRCQCRNGAKCNPITGACVCTDGFQGWRCEEPCDPHLYG
KDCLLECQCLNGATCQHRTGECLCAPGYTGAFCEEPCPAGKHGALCEQRCPCQNGGECHH
VTGRCSCPAGWVGPVCAQPCSFGSFGINCSEECTCRNGGLCDHISGQCQCTAGYVGERGR
DECPGGTYRPQCASCDCQNGAKCYHINGACLCPEGFKGPACRDRCPAGLYGLFCDKNCPL
LESLPPSCHPLSGEGTLPAVAGSTCNEDCRRLLREAARACALLKPAQWQPREGGLAQAEG
LQGDDCSVRCPAGLYGTNCSSSCSCRHAASCSHLDGSCVCTEGWQGVDCSLPCSSGTWGP
SCNQTCQCSNAAACDPVNGTCACSPGWRDEYCDLPCPEGSYGLDCGERCDCVNADGCDPV
SGFCRCAAGWTGGS
Download sequence
Identical sequences G3PZ23
ENSGACP00000022863 ENSGACP00000022863 69293.ENSGACP00000022863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]