SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024230 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024230
Domain Number 1 Region: 182-251
Classification Level Classification E-value
Superfamily Homeodomain-like 1.67e-19
Family Homeodomain 0.0029
Further Details:      
 
Domain Number 2 Region: 58-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000281
Family LIM domain 0.014
Further Details:      
 
Domain Number 3 Region: 29-56
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000143
Family LIM domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024230
Domain Number - Region: 119-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0336
Family LIM domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024230   Gene: ENSGACG00000018323   Transcript: ENSGACT00000024278
Sequence length 377
Comment pep:known_by_projection group:BROADS1:groupXIV:13873722:13900598:-1 gene:ENSGACG00000018323 transcript:ENSGACT00000024278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNDIKIEDRLRTDAGSLDGMIGGDSLQRAVCEGCTRVISDRFLLRVNDASWHEECLQCA
ACQRPLTTTCYVRDTRLYCRSDYQQLFATKCSGCLEKIAPTEFVMRALESVYHLSCFCCC
VCDRQLCKGDEFVLKGGQLLCKSDYERERDLLSAASPDNSDSEKSEDEDVDVKSEKCPSA
GRGSGDSKDPRRPKRPRTILNTQQRRAFKASFEVSSKPCRKVRETLAAETGLTVRVVQVW
FQNQRAKMKKLARRQQQQQEQHSGQRLSQERMSGCMEGLLSSYSGHLAPNQQQQLVTMEH
GGYHTDPFQQGLTPPQMPGDHMNPYGTDIIFHDMDSDTSLASLNDGFVAPADVSSSHRGA
GNPIDRLYSMQSSYFAS
Download sequence
Identical sequences G3Q2Y1
69293.ENSGACP00000024230 ENSGACP00000024230 ENSGACP00000024230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]