SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024744 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024744
Domain Number 1 Region: 830-1099
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.66e-69
Family Tandem AAA-ATPase domain 0.000021
Further Details:      
 
Domain Number 2 Region: 578-828
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.92e-55
Family Tandem AAA-ATPase domain 0.0000606
Further Details:      
 
Domain Number 3 Region: 333-380,407-453
Classification Level Classification E-value
Superfamily Chromo domain-like 7.69e-17
Family Chromo domain 0.016
Further Details:      
 
Domain Number 4 Region: 473-544
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000000000134
Family Chromo domain 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024744
Domain Number - Region: 84-124
Classification Level Classification E-value
Superfamily HMG-box 0.000838
Family HMG-box 0.0058
Further Details:      
 
Domain Number - Region: 218-259
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00658
Family PHD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024744   Gene: ENSGACG00000018705   Transcript: ENSGACT00000024793
Sequence length 1807
Comment pep:known_by_projection scaffold:BROADS1:scaffold_208:61409:76736:1 gene:ENSGACG00000018705 transcript:ENSGACT00000024793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLVGAEEAEGQRSDSEGSDYTPGRKKKRRGGSGKEKKRSSSGAERSSSRKKEPEPEEPK
SSSQLLDDWGMEDIDHVFNEEDYRSLTNYKAFSQFVRPLIAAKNPKIAVSKMMMVLGAKW
REFSTNNPLRLRKAKTKEGKGPNARKKSKPTPKQLEKKNSAKTKKVAPLKIKLGGFSSKR
KRSSSEEDEPEVDSDFEDGSITGFSFSEGYNNRSIRTKKKPSKSNPKKKKAEEGDGYETD
PQDYCEVCQQGGEIILCDITYQGHTHSLDPDQRGLFRGLSGSPHREKEGIQWEAREEASE
GEEDIGDTGDMEEDDLHMEFCRVCKDGGELLCCDSCPSSYHIHCLNPPLPEIPNGEWICP
RCTCPSMKGKVQKILTWRWGEAPPPTPVPRPLDLAADAPDPKPLAGRPDREFFAKWSNMS
YWHCSWVTELQLELHCQVMFRNYQRKNDMDDPPPIDFAEGEEDKSVKRKAKDPMYAQLDE
KYLRFGIKFEWLMMHRIINHSVDRKNNVHYLIKWRELAYDQATWEADDMDIPDYDTYKVQ
YWNHRELMMGDEGKPGKKIKVKGRVKRPDRPPENPVVDPTIKFERQPDYLDSTGGTLHPY
QLEGLNWLRFSWAQGTDTILADEMGLGKTVQTAVFLYSLYKEGHSKGPFLVSAPLSTIIN
WEREFEMWAPDMYVVTYVGDKDSRAVIRENEFSFEDNAIRGGKKASRMKKDSSIKFHVLL
TSYELITIDMAILGSIDWACLVVDEAHRLKNNQSKFFRVLNNYPLQHKLLLTGTPLQNNL
EELFHLLNFLTPERFSKLEIFLEEFADIAKEDQIKKLHDMLGPHMLRRLKADVFKHMPSK
TELIVRVELSPLQKKYYKFILTKNFEALNTKGGGNQVSLLNVVMDLKKCCNHPYLFPTAA
IEAPKMPNGMYDGNSLTKAAGKLTLLQTMMRKLKAGGHRVLIFSQMTKMLDLLEDFLENE
GYKYERIDGGITGGMRQEAIDRFNAPGAPQFAFLLSTRAGGLGINLATADTVIIYDSDWN
PHNDIQAFSRAHRIGQNKKVMIYRFVTKASVEERITQVAKKKMMLTHLVVRPGLGSKTGS
MSKQELDDILKFGTEQLFKDEFDGGLGENKNKEEDSSVIHYDEKAIDRLLDRNQDATEDK
ELQSMNEYLSSFKVAQYVVKDEEEEEEEVQREIIKQEESVDPDYWEKLLRHHYEQQQEDL
ARNLGKGKRIRKQVNYNDGSQEDRADWQDDQSDGQSDYSVASEEGDEDFDERTEANSRRP
SRKGLRNDKDKPLPPLLARVGGNIEVLGFNSRQRKAFLNAVMRYGMPPQDAFTTQWLVRD
LRGKSEKEFKAYVSLFMRHLCEPGADGAETFADGVPREGLSRQHVLTRIGVMSLIRKKVQ
EFEHVNGQWSMPWMAELEESKKAAAAGQPDSPGKTPSTGTPADTQPNTPAPGKAPPPPRS
SPRTHPREARRKRPNEVFLGSLSTGDDSNSKCSPSPESSEGGEDTKSTPEAKAEGSEVKP
EDAEVKAEEKKEEKMDVALPADEKKGGERVSSPSTRSRSSRALLSDLKDEKEPLKAEDVA
KLQNGDGSKEGGASEEKKKAKSRFMFNIADGGFLCPLSELHSLWQNEERAATVTKKTNEI
WHRRHDYWLLAGIIQHGYARWQDIQNDVKFAILNEPFKGEMNRGNFLEIKNKFLARRFKL
LEQALVIEEQLRRAAYLNMSEDPSHPSMALNTRFSEVECLAESHQHLSKESMSGNKPANA
VLHKVLKQLEELLSDMKADVTRLPATIARIPPVAVRLQMSERNILSRLASRGPETQTQSQ
TQQMSQQ
Download sequence
Identical sequences G3Q4E0
ENSGACP00000024744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]