SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025674 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025674
Domain Number 1 Region: 317-574
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.79e-74
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 164-272
Classification Level Classification E-value
Superfamily Kringle-like 3.87e-28
Family Kringle modules 0.00034
Further Details:      
 
Domain Number 3 Region: 4-49
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000101
Family Fibronectin type II module 0.0057
Further Details:      
 
Domain Number 4 Region: 57-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000699
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 96-136
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000108
Family Fibronectin type I module 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025674   Gene: ENSGACG00000019423   Transcript: ENSGACT00000025724
Sequence length 575
Comment pep:known_by_projection group:BROADS1:groupVII:4511540:4518737:-1 gene:ENSGACG00000019423 transcript:ENSGACT00000025724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFTTTDKECKFPFRQGGRIHHNCLTVLSSKPWCSLTSNFDRDRQWGFCASGQTPRRNTDP
CAVNPCQNGGACTPISHSRWFECSCPDRFTGTVCEKKKCYETAHLHYYDIGESWGRIRLR
NVEQCTCVSGEIECERTRYSTVCRSNPCQNDGTCRLITSTGKEVCNCRSGHSGPRCGLAD
PEAECYNHRGRDYRGLANTTLSGARCLPWNSDLLYDELHVGAAAASALKGLGEHAYCRNL
DDDKMPWCYTLHEGAISWEYCDVPSCVMSASNELINKQTNIHSSGRGKTPPKNIPQLDSR
SPVSSRSASSFTSTIRLITTACGKKHQKRRSVAMGRIFLGTAALPGSHPWMAAIYIGKSD
FCAGTLVSSCWIVSAAHCFFRNPLMSQLRVVLGQHSFNATGPNTRTFGVEKYIFPKQFSV
FNPTLHDIVLIKLAKQDGRCVRRTPFIAPVCLPDKSTTFPDGYCCTISGWGHIDEKAEGY
SSLQEAGVRLVPHEVCRRPDVFGNHVTADMICAGLSGCADACQGDSGGPLACARNDVSFL
YGIISWGEGCGTSGKPGVYTKVVNYIDWINSVIRR
Download sequence
Identical sequences G3Q714
69293.ENSGACP00000025674 ENSGACP00000025674 ENSGACP00000025674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]