SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026252 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026252
Domain Number 1 Region: 27-309
Classification Level Classification E-value
Superfamily L domain-like 6.8e-51
Family Ngr ectodomain-like 0.05
Further Details:      
 
Domain Number 2 Region: 416-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000355
Family EGF-type module 0.026
Further Details:      
 
Domain Number 3 Region: 479-547
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000153
Family Fibronectin type III 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026252   Gene: ENSGACG00000019871   Transcript: ENSGACT00000026303
Sequence length 655
Comment pep:known_by_projection group:BROADS1:groupIX:19817608:19819572:-1 gene:ENSGACG00000019871 transcript:ENSGACT00000026303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPGAMRPHFLLLFLSSGLVLSSECPADCVCRDQDSVFCFHRRSSTVPRVPATTRELFIFQ
SSINTLTQDDFKDLVELELLDLSQNELAEIPGGAFEMLSKLRNLDLSFNRITHISKDSFS
GLVQLERLYLHANLIQSIHSEAFEGFEMLLELKLQGNQLTSLPSLRLPRLLLLDLSYNNI
PTLGPSDLQTPHLEALKVASLGLTTVNEDLIASLGNLHELDISNNQLSELPQALKHDSLK
GLTKLSLATNPLSELRVEDFQSLSGLQELDLSGLNLQGFSQSFFQTFPRLMHLTAAENPF
NCLCPLAWFPVWLKDKNVDLGRPEETRCHFPLVNAGKMLSALEHKDFGCPSIRTVLTGVP
IGSTIAPRIPATSPGTIHTNAILPPPPSEATASSNTHGTLSPEPPVSQSSTSGEHICPLN
ICLNGGTCHFDPSGQLGCLCPSGTSGLYCENVDQASETPKPSAAKVLQAAAMPAELDAIS
SRQVTSTSILLDLHRFIETRPHIRGIRLTYRNLSGPDRRPIILSVPASYPEYTLRGLRPN
CTYSVCASPLRERVAPRANGSAETGSCTEARTEGPPLSSSQPRVETQSPLTYTLVLAVAA
LALVTGLAVVAGAIVCVRKRRQSRAELELELDPAGPDPVGQEGVKACLENGANGT
Download sequence
Identical sequences G3Q8N8
ENSGACP00000026252 69293.ENSGACP00000026252 ENSGACP00000026252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]