SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026830 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026830
Domain Number 1 Region: 169-234
Classification Level Classification E-value
Superfamily Homeodomain-like 1.41e-20
Family Homeodomain 0.0014
Further Details:      
 
Domain Number 2 Region: 30-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000152
Family LIM domain 0.0081
Further Details:      
 
Domain Number 3 Region: 3-28
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000428
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026830   Gene: ENSGACG00000020307   Transcript: ENSGACT00000026882
Sequence length 394
Comment pep:known_by_projection group:BROADS1:groupVII:16327636:16330962:1 gene:ENSGACG00000020307 transcript:ENSGACT00000026882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQCSSCEKPILDRFLLKVLDRPWHIKCVQCCECKCTLSEKCFSREGRLYCKNDFFRTFG
TKCDGCAQGILPSDLVRRAKSKVFHLNCFTCVMCNKQLSTGEELYILDEFKFVCKEDYQN
NNGKDTILLSVTTCSDPSLSPGSQDPQDDGKDSEAGHLSDKENDEQGAVGKRRGPRTTIK
AKQLETLKAAFAATPKPTRHIREQLSRETGLTMRVIQVWFQNRRSKERRMKQLSSLGGRR
HVFFRGQRRMRALGERLEAEELGHFSYYGDYPGEYYGSGGNYEYYQGPPSSHAQTPADLG
FVPSSVPAGTPLGAMDHHHPGHHFPGEVHCFSDTVSHHPADSPSPEPNMPGSMHSISSEM
CGPSTPYTTVSLSDNGYTNQLSQPSSEMSEGTVW
Download sequence
Identical sequences G3QAB4
ENSGACP00000026830 ENSGACP00000026830 69293.ENSGACP00000026830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]