SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027032 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027032
Domain Number 1 Region: 54-206
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-24
Family C-type lectin domain 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027032
Domain Number - Region: 281-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027032   Gene: ENSGACG00000020442   Transcript: ENSGACT00000027084
Sequence length 305
Comment pep:known_by_projection group:BROADS1:groupVII:18632237:18634024:-1 gene:ENSGACG00000020442 transcript:ENSGACT00000027084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKTIRSGSSGSSMPLLCALWLLMVCLAPGGQSQRLRETGAEQPAASGQLAERDALCHQK
GCYAVFFQKRNFREAGRSCRERGGTLATMHTDEAAAVVHKLLFAIEGTKSRLRLWIGLHR
SSRQCSSTRALRGFVWVTGDQDGQFTNWLHEENPGTCTVPRCVAMNVHTSESGRESKDNF
QWVDGSCALPLDGYVCQYIYKGMCPPLEDEGSGPALYTTPFHLLSSLLTHVPHNSMATLP
CPTDGSDPEAPAEQTVLCTERDDKTVGWSKDAPLCSLHRQDWCSRDHGCEQHCQNTDTDY
YCYCS
Download sequence
Identical sequences G3QAW6
ENSGACP00000027032 69293.ENSGACP00000027032 ENSGACP00000027032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]