SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0143988 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0143988
Domain Number 1 Region: 68-241
Classification Level Classification E-value
Superfamily L domain-like 4.76e-35
Family Leucine rich effector protein YopM 0.039
Further Details:      
 
Domain Number 2 Region: 655-749
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.75e-20
Family Calponin-homology domain, CH-domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0143988   Gene: FBgn0117563   Transcript: FBtr0145496
Sequence length 1153
Comment type=protein; loc=scaffold_15252:complement(16612620..16612808,16616064..16617119,16617416..16617493,16618147..16618284,16618441..16619101,16619994..16620613,16622182..16622699,16631382..16631583); ID=FBpp0143988; name=DgriGH10082-PA; parent=FBgn0117563,FBtr0145496; dbxref=GB_protein:EDW04258,FlyBase:FBpp0143988,FlyBase_Annotation_IDs:GH10082-PA,REFSEQ:XP_001989391,FlyMine:FBpp0143988; MD5=7f88dd8325bbd7ef8416f45486f0a641; length=1153; release=r1.3; species=Dgri;
Sequence
MAATVYKRLQHASGVGGGGGGGGLLSSSTSPAGIGLGVGGGGVASPMLGQSQLTRSLERI
LEEAHFSDLSRNRFCELPEEITTFAFLETLMLYHNTIRSIPESVKQLSSLTYLDLRSNQL
TTLPREICFLPLQVLLVSNNRLASLPDELGRLDQTLTDLDASYNQLSALPVRLGELRTLR
SLSLRSNQLLYLPREVTCLSLVSLDVSNNRIAGLPLEIRHMSTLVELQLENNPLTSPPAS
LCMRGLVHVFKFLETQATKDEKGSRVGGNYDGYTTLRRAPRHNSSGNMLETSTSQRHAAR
HQIDSGYSTSDGLDKRWSHDVPGKSKTDSPMHCATLPRALPSSTNSQSHQQLLPLSSDLM
DASLTSSTSTIVDESLTLSAGISPVASPYKQSTSSSHNNISYAHSNSSSNSSSPDQDEDL
MLDHQERSVHGSNGKLNKSLNNIQTYKEYKDALKQQRNQEISSVYKQKHPNANTSPNEEE
LPPRCLSNGSSTATLPKSIMKQPSSNGHNGNGNGNGNGIDDVVIPKKPIQKVIPSRNTEL
MSTLALKSPVASETNGAHCVGYVKPHSPLKNGVGIGVGVGVLTNSNNNGSGSSKFNTSNG
SGAGGGAVGGSGLIKSPVSATSKLGNVKTHRTVTWNHDIPAEKLSFTMRREFDRQREETE
LMSQLRSIIETRLKMTLPEDIASALTDGVILCHLANYVRPRSVASIHVPSPGVNKLSMAR
CRRNVDNFLEACRRIGVDEELICYCADVVPQQHQEQRADDDYDADVYVADSSSSSSNSCN
GHGNDSNNSNSSSNIERRQLPNAVALLRTVAALIALDANPHHQQQHVRCLQQQEQLQLKL
QQLQQQQQQFSSSKFNSCSQQPEQMLQLANVFIGHDNNVDADVDDDDVAATSQPQQQQLP
PQQQQQPLATVGQLLRSAKLKTFDKIKKNLLLNGHQSFQLHHSNNNSSSSNNNNNRCSTL
QTIIESEHDVASAGPAGHYHLIDEKQQQQQLQQQQQLQQQHQQQQQLQPKDLPTIKPLAK
RIEFFEQQPQLEVFSIYQQPQQQLQLPQQQLPPHKLQQQEHEAGNLSLLKHDSHTLTIIL
SCVFIASFLWLNLICCSADVLEGKGAVQVSITVGELFRLHGSCTGSGNNSGAATPTKSPT
RTTRATLSPTPLV
Download sequence
Identical sequences B4JD14
FBpp0143988 7222.FBpp0143988 XP_001989391.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]