SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0144087 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0144087
Domain Number 1 Region: 35-75
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000298
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 82-223
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0000000203
Family mannose-1-phosphate guanylyl transferase 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0144087   Gene: FBgn0117662   Transcript: FBtr0145595
Sequence length 236
Comment type=protein; loc=scaffold_15252:complement(13487125..13487341,13487560..13487819,13488668..13488901); ID=FBpp0144087; name=DgriGH10181-PA; parent=FBgn0117662,FBtr0145595; dbxref=GB_protein:EDW04058,FlyBase:FBpp0144087,FlyBase_Annotation_IDs:GH10181-PA,REFSEQ:XP_001989191,FlyMine:FBpp0144087; MD5=dd42222e51e30faae9fb4041d6f162fb; length=236; release=r1.3; species=Dgri;
Sequence
MHRSSHGSIKSSLSLRSSGKSFQVKLDKMSEHLYDIVKSGSMVKQAQNKKRFTPVNYKHR
WFELTKRTICYYDVENVELHGADKFRVLELVQNRGKGGAVRLGMLSARGRQLLFADADGA
TKFAVYDKLAETLTSVAPEWRHDGIAIGSRAHLENESIARRSFFRLHVQRWAFDVELLYL
AERLRLPMVEVAVRWTEIDGSKLSPFWSWLQMGIDLFMIWLRYLIGAWRLSASQKN
Download sequence
Identical sequences B4JBV5
XP_001989191.1.65300 FBpp0144087 7222.FBpp0144087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]