SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0144805 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0144805
Domain Number - Region: 10-43
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0451
Family Pentapeptide repeats 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0144805   Gene: FBgn0118380   Transcript: FBtr0146313
Sequence length 153
Comment type=protein; loc=scaffold_15252:join(479133..479378,481036..481251); ID=FBpp0144805; name=DgriGH10899-PA; parent=FBgn0118380,FBtr0146313; dbxref=FlyBase:FBpp0144805,FlyBase_Annotation_IDs:GH10899-PA,GB_protein:EDW02815,REFSEQ:XP_001987948,FlyMine:FBpp0144805; MD5=1e4fa92603b484c396f84abc4a5f254e; length=153; release=r1.3; species=Dgri;
Sequence
MHSKDMVDMARLDLAKVDMARLDLAKVDMARLDMARLDLADMERTANLDLARVDMAMLDF
TMVDVAMVHMVDKVAMVAMVAAIILFALFAAAFALPQFGNGFGRASGGGGGGSGNRGGNR
GGGSNHHHNPHHNPHHNPHHNPHHNPHHNPHHH
Download sequence
Identical sequences B4JAM9
FBpp0144805 7222.FBpp0144805 XP_001987948.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]