SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0144855 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0144855
Domain Number 1 Region: 3-153
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-43
Family Protein kinases, catalytic subunit 0.0000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0144855   Gene: FBgn0118430   Transcript: FBtr0146363
Sequence length 203
Comment type=protein; loc=scaffold_3825:join(62..147,211..736); ID=FBpp0144855; name=DgriGH10949-PA; parent=FBgn0118430,FBtr0146363; dbxref=FlyBase:FBpp0144855,FlyBase_Annotation_IDs:GH10949-PA,GB_protein:EDW04649,REFSEQ:XP_001998137,FlyMine:FBpp0144855; MD5=f41f61f0a825ed2ce183bd3ad78038fa; length=203; release=r1.3; species=Dgri;
Sequence
GDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIR
DADPLDVKRERIVRLMNHFTVRGVNGVHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNI
IKQVLEGLDYLHSKCSIIHTDVKPENILLVIDNAAAMNQQIDDEINSLRVKGADFPDSYS
KNSIAFSALVDGWIICHFVPSHP
Download sequence
Identical sequences B4K4D3
FBpp0144855 XP_001998137.1.65300 7222.FBpp0144855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]