SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0146577 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0146577
Domain Number 1 Region: 14-56
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000000222
Family Calponin-homology domain, CH-domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0146577   Gene: FBgn0120150   Transcript: FBtr0148085
Sequence length 56
Comment type=protein; loc=scaffold_15203:join(6775298..6775418,6775489..6775538); ID=FBpp0146577; name=DgriGH12671-PA; parent=FBgn0120150,FBtr0148085; dbxref=GB_protein:EDW00092,FlyBase:FBpp0146577,FlyBase_Annotation_IDs:GH12671-PA,REFSEQ:XP_001991467; MD5=18e46d46eabd799d4f1f7a9a53a0b7a1; length=56; release=r1.3; species=Dgri;
Sequence
MDPNNVQSKNVSKNLSRFKVLFWVNEKMDTEILKVEELCIGAVYCQLMDMLFPDAV
Download sequence
Identical sequences B4JKI6
7222.FBpp0146575 7222.FBpp0146577 FBpp0146575 FBpp0146577 XP_001991464.1.65300 XP_001991467.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]