SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0146593 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0146593
Domain Number 1 Region: 179-285
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.12e-36
Family Calponin-homology domain, CH-domain 0.0000904
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0146593   Gene: FBgn0120166   Transcript: FBtr0148101
Sequence length 288
Comment type=protein; loc=scaffold_15203:join(6927810..6927980,6928420..6928495,6936773..6936865,6936934..6937036,6938065..6938212,6938953..6939104,6939182..6939305); ID=FBpp0146593; name=DgriGH12687-PA; parent=FBgn0120166,FBtr0148101; dbxref=FlyBase:FBpp0146593,FlyBase_Annotation_IDs:GH12687-PA,GB_protein:EDW00114,REFSEQ:XP_001991489,FlyMine:FBpp0146593; MD5=7ee28c99522f214e02ae59c7d9763b50; length=288; release=r1.3; species=Dgri;
Sequence
VKTTRISSSYSSNSSNSNTGNISSSSNTTRKITSSAPVTRTTCDIEEIWDEQLLRQLLEQ
ASTYEERRKIRARLRELMAEREAQHKQQSSTTSERTETKSKDGGAVVTTTTTKVTTRTVS
GNAATKNISPLAKFKQLDKAAAQQQAQKSSPTTSTPTTPGGSAQPYFKFTDPALNARAAT
VKDQLLQWCQHKTQEYENVQISNFSSSWSDGLAFCALIHHFLPDAFDYSELTKQTRRHNF
ELAFSVADEKAGIAPLLDVEDMVEMSRPDWKCVFVYVQSIYRRFRNCQ
Download sequence
Identical sequences B4JKL1
7222.FBpp0146593 FBpp0146593 XP_001991489.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]