SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0146627 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0146627
Domain Number 1 Region: 9-125
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.25e-33
Family Calponin-homology domain, CH-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0146627   Gene: FBgn0120200   Transcript: FBtr0148135
Sequence length 149
Comment type=protein; loc=scaffold_15203:7505721..7506170; ID=FBpp0146627; name=DgriGH12721-PA; parent=FBgn0120200,FBtr0148135; dbxref=GB_protein:EDW00168,FlyBase:FBpp0146627,FlyBase_Annotation_IDs:GH12721-PA,REFSEQ:XP_001991543,FlyMine:FBpp0146627; MD5=d49d1d124ded72dc7f02f3f7161d090d; length=149; release=r1.3; species=Dgri;
Sequence
MGNEYRIAKNVVLTRNSKEQFSKIKILNWVNETLESNLSRIKDLCTGAAYCNLMDILFPN
LIQMRNVKFMGNQKIDYIKNFKLLQQGFNKLQVNVSFDIQELIKGNYRENYQFANWFKVF
YDRNFESICKNYCAKKARGYQEIGMAISN
Download sequence
Identical sequences B4JKR5
FBpp0146627 XP_001991543.1.65300 7222.FBpp0146627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]