SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0147547 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0147547
Domain Number - Region: 49-86
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 0.0595
Family Cryptochrome/photolyase FAD-binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0147547   Gene: FBgn0121117   Transcript: FBtr0149055
Sequence length 94
Comment type=protein; loc=scaffold_15126:2951515..2951799; ID=FBpp0147547; name=DgriGH13641-PA; parent=FBgn0121117,FBtr0149055; dbxref=FlyBase:FBpp0147547,FlyBase_Annotation_IDs:GH13641-PA,GB_protein:EDV99030,REFSEQ:XP_001993105,FlyMine:FBpp0147547; MD5=ef311cf9f0cb6e022f6d718b64a75845; length=94; release=r1.3; species=Dgri;
Sequence
MPRTKIGKRKRLLQRKEAEQEEQLRMAEMKLEATLEKIDELGKNCIQQVNNRMQLILART
HKHVLQMKWSAFLKLQLDHFADYQWIGTSLVNRN
Download sequence
Identical sequences B4JQ50
7222.FBpp0147547 XP_001993105.1.65300 FBpp0147547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]