SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0147738 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0147738
Domain Number 1 Region: 24-134
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-24
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0147738   Gene: FBgn0121308   Transcript: FBtr0149246
Sequence length 1362
Comment type=protein; loc=scaffold_15126:join(7097609..7097683,7099627..7099797,7135417..7135823,7165739..7165869,7167057..7167165,7167244..7168878,7183233..7183795,7184394..7184538,7184605..7184913,7188518..7188867,7188958..7189151); ID=FBpp0147738; name=DgriGH13832-PA; parent=FBgn0121308,FBtr0149246; dbxref=FlyBase:FBpp0147738,FlyBase_Annotation_IDs:GH13832-PA,GB_protein:EDV99409,REFSEQ:XP_001993484,FlyMine:FBpp0147738; MD5=eb9500d51f8965985f798640b9927eef; length=1362; release=r1.3; species=Dgri;
Sequence
MLGRCVSYQGSCDNINGILTRDYAKIYTDWANYYLERSKSKRKVTDLSADCRDGLLLAEV
IEAVTNFKVPDLVKKPKNQQQMYDNVNSCLHVLRSQSVGGLDNITTNDICAGRLKAVLAL
FFALSRYKQQAKQTKSIGVGCGGAASTVGATAAPGGGGGSVLGIGLGGSLRASVASNLLD
KHQQEKQQQQLLQQQQQQQQTPQQLAQSLENGNEMVNRQIPPAYGKVNGGTAIPLPATVM
VQRRCPPDKVRPLPPTPNHTPSIPGLGKSGSDFNTSRPNSPPTSNHTIQSLKSGNNNSLR
PPSVKSNHQSGIPSPSSLNAPTISAPQKHSMLDKLKLFNKEKQQNAANAAAVASNKTQIQ
SKRTSSSSGFSSARSERSDSSLSLNDGHNSQLKPPSISVSAQQKSQQKHNTKQSKLLAAQ
QKKDQSKAVAAAAAAAKKEKSPARSLHKEELQQQSGNESRSSTMGRAVKSSLTRGSAEKT
SSKSSLHSKTDSLKSQSQQQQQQQQQLLHSPSGTALPKPIAAIKGTSKLPQLGSSCSSNS
ELFKRETSDISTNSSNQANISQQQQQQQSTANTHILKALPSTPPPPYYANAPPTPPPPTA
SHISATYSNSVSGYLSEPSTPQHGHSLYSSSSGSRLPPPKSALGGSAPRKLEYNAGPHIL
GAPPRSPLQRVPMQHNSAPNTPTASPSKFHTIPSKIVGTIYESKEEQLPSAAAAASSSSC
SSSVLPMRPLLRGYNSHVTLPTRGARGGQPHHHPHPHPHPHQSYLEFCESDIGQGYCSDG
DALRVGNSTSGSRYHHDIDNGYLSEGSSGLSTAAGSAIGVSHGKHFLSMMRARTQLPTTI
EERIRSSRGSLDSIGTAANGSSAASQASSSGGSTSNSNSHNNNNNNNNNNVNKMDGSPHH
RPGSRNGRDNWGKMPEPLNGHKADKSEKSSPSRRNIGGGGSGSSSKQGSPSSSSRTKGVP
PSFGYVKRANGSIASTAEQQNIAMLMATGGATGLVNGLPCGRTAHVSAVPRTASGRKVTG
GTQTLPNDMNKLPPNTQHRSFSLTGPTATQLSQSIRERLATGSHSLPKPGSDMHVFQHRV
STRGGSTRHDGSLSDTQTYAEVKPEYSSYAMWLKHSNTAGSRLSDGDAIDQMQIGSPAMT
RHGHKMLHNRSTGAAGQGQMTVQGNESPYVQSPRMNRSNSIRSTKSEKMYRPMLSRGVDL
EIEPYYCLPVGTSRMLSAQMAAAVVHSQTDNVAAVAWSQPTSPTPLNRGPFAGGAASALS
PTHGTAAAALAAVAAAAGGERSSVNASHRLTYPKKNDEVHGSAASLLSGGSSLYGSAEER
QANEIRRLKRELQDAREQVLSLSSQLSTNVSNPIAPNLQNHS
Download sequence
Identical sequences B4JR79
FBpp0147738 XP_001993484.1.65300 7222.FBpp0147738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]