SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0148160 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0148160
Domain Number 1 Region: 396-639
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.22e-78
Family Calponin-homology domain, CH-domain 0.0000874
Further Details:      
 
Domain Number 2 Region: 8-237
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.49e-69
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 1315-1426
Classification Level Classification E-value
Superfamily E set domains 4.74e-34
Family Filamin repeat (rod domain) 0.0000372
Further Details:      
 
Domain Number 4 Region: 240-366
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-31
Family Galectin (animal S-lectin) 0.00036
Further Details:      
 
Domain Number 5 Region: 832-949
Classification Level Classification E-value
Superfamily E set domains 3.07e-29
Family Filamin repeat (rod domain) 0.00087
Further Details:      
 
Domain Number 6 Region: 2010-2104
Classification Level Classification E-value
Superfamily E set domains 5e-27
Family Filamin repeat (rod domain) 0.0000647
Further Details:      
 
Domain Number 7 Region: 2207-2297
Classification Level Classification E-value
Superfamily E set domains 2.87e-26
Family Filamin repeat (rod domain) 0.000042
Further Details:      
 
Domain Number 8 Region: 1831-1921
Classification Level Classification E-value
Superfamily E set domains 1.47e-25
Family Filamin repeat (rod domain) 0.0000487
Further Details:      
 
Domain Number 9 Region: 754-865
Classification Level Classification E-value
Superfamily E set domains 2.2e-25
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 10 Region: 1507-1622
Classification Level Classification E-value
Superfamily E set domains 2e-24
Family Filamin repeat (rod domain) 0.0004
Further Details:      
 
Domain Number 11 Region: 654-751
Classification Level Classification E-value
Superfamily E set domains 3.94e-24
Family Filamin repeat (rod domain) 0.00053
Further Details:      
 
Domain Number 12 Region: 2394-2483
Classification Level Classification E-value
Superfamily E set domains 1e-23
Family Filamin repeat (rod domain) 0.00015
Further Details:      
 
Domain Number 13 Region: 1043-1136
Classification Level Classification E-value
Superfamily E set domains 1.4e-22
Family Filamin repeat (rod domain) 0.00086
Further Details:      
 
Domain Number 14 Region: 952-1042
Classification Level Classification E-value
Superfamily E set domains 8.01e-22
Family Filamin repeat (rod domain) 0.00019
Further Details:      
 
Domain Number 15 Region: 1119-1225
Classification Level Classification E-value
Superfamily E set domains 1.4e-21
Family Filamin repeat (rod domain) 0.00053
Further Details:      
 
Domain Number 16 Region: 2523-2613
Classification Level Classification E-value
Superfamily E set domains 3.07e-21
Family Filamin repeat (rod domain) 0.0000551
Further Details:      
 
Domain Number 17 Region: 1244-1349
Classification Level Classification E-value
Superfamily E set domains 4.2e-20
Family Filamin repeat (rod domain) 0.00078
Further Details:      
 
Domain Number 18 Region: 2299-2391
Classification Level Classification E-value
Superfamily E set domains 1.27e-18
Family Filamin repeat (rod domain) 0.00017
Further Details:      
 
Domain Number 19 Region: 2124-2201
Classification Level Classification E-value
Superfamily E set domains 2.07e-18
Family Filamin repeat (rod domain) 0.0002
Further Details:      
 
Domain Number 20 Region: 1422-1527
Classification Level Classification E-value
Superfamily E set domains 5.4e-18
Family Filamin repeat (rod domain) 0.0008
Further Details:      
 
Domain Number 21 Region: 1766-1841
Classification Level Classification E-value
Superfamily E set domains 6.67e-18
Family Filamin repeat (rod domain) 0.00049
Further Details:      
 
Domain Number 22 Region: 1909-2008
Classification Level Classification E-value
Superfamily E set domains 1.93e-16
Family Filamin repeat (rod domain) 0.0000751
Further Details:      
 
Domain Number 23 Region: 1624-1716
Classification Level Classification E-value
Superfamily E set domains 0.0000000000214
Family Filamin repeat (rod domain) 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0148160   Gene: FBgn0121730   Transcript: FBtr0149668
Sequence length 2613
Comment type=protein; loc=scaffold_14624:join(2310340..2310625,2310681..2310825,2310937..2311223,2311793..2311871,2311931..2312285,2322718..2323057,2332884..2333028,2333109..2333444,2335128..2335219,2335284..2336576,2336652..2337038,2338722..2339526,2339597..2340049,2340119..2340254,2343333..2343416,2343742..2343832,2350408..2350548,2350618..2350787,2350847..2352878,2352946..2353130); ID=FBpp0148160; name=DgriGH14254-PA; parent=FBgn0121730,FBtr0149668; dbxref=GB_protein:EDV90656,FlyBase:FBpp0148160,FlyBase_Annotation_IDs:GH14254-PA,REFSEQ:XP_001995998,FlyMine:FBpp0148160; MD5=0a2b7471e7389146d6df1d11338e59db; length=2613; release=r1.3; species=Dgri;
Sequence
MEAEYNLGEHAQWKEIQQNTFTRWTNEHLKTVGSSLDNLETDLSDGLRLITLAEVLSQKR
LPPHNARPTFRVQKLENVSVALTFFQNEGIKIVNIDASNIVDGNLKLIMGLIWTLILHYS
ISTPIWDDDKEQPPTESVQTPKQRLLTWIQMKIPDMCINNFTKDWTTGKPIGALVDACAP
GLCPDWELWNPVESVRNATEAMVLADDWLDVRQLITPAELVDPNVDEQSVMTYLAQYPNY
YFTEIGQLYEGATFLFTGLVSLNCDRFSINFVHGNNNRDVALHINPRFFEQRIITNTEIH
NKWGREEIPATLPFLLGQGERFAIQVLVTQTCYLIAINGHHLSAYSHRLAYDAVRFLEVK
GDVGEVRMHSSMVRGYPQSFFETAQQQQHQQSEEYDENFDEDMEAERDLAEDAQWKKIQQ
NTFTRWANEHLKTIDRSINNLETDLSDGLRLIALIEVLSQKRLPKYNKRPTFRSQKLENV
SVALKFLQDEGIKIVNIDSSDIVDCKLKLILGLIWTLILHYSISMPMWDGEDEKQLNGSG
HTPKQRLLNWIHARIPDMPINNFTNDWTTGKAVGALVDACAPGLCPDWEMWDPKDAVQNA
SEAMGLADDWLNVRQLIKPEELVNPNVDEQSMMTYLSQYPNSKLKTGAPLRPKTNPNRVR
AYGPGIEPIGPVVGAPANFTVETFSAGKGAVDVNIEGPNGVVEKADVRFNNDKNLTYTIS
YIPKEEGDLKVAVKFSGRDIPKSPFPVKVEGHAGDASKVKVTGPGIQPSGVTVKKPTFFD
ILAKDAGRGVPEVIIIDPANHKTSVAAKVRQLEDDTWRCEYVTAQQGLHSVNVFFAGTPI
PNSPFPVKVAPLSDARKVRVSGRGLQATGVRVGDDADFKIHTEGAGEGVPEVRVIGPGGM
NQNVMQSKVDGNTYECHYYPTKEGRYVVMVTFSGQEVPKSPFDVKVGPKKESSIVAYGPG
LNSGVIGYPAAFVVETNGETGALGFTVAGPSQAEIECHDNGDGSALVKYHPTAVGEYAVH
ILCDNEDIPKSPFIAQILPRTDFHPELVKASGPGLAKNGVTINQSTSFDVDTSKAGNAPL
DVIVQDVYGNKLPVQIKNNPDGTKKVSYTPTSGVPHTVEVNYGGVSTPNSPHRIYVGVPV
DASKVQSFGPWLQPGVRPNVATHFNVDARDAGEAELKVKVVHEDTKLDVPCRIIDNEDST
YSVEVIPPMKGAYTTTMTYGGQRVPLGQKVVVEQTVDVSKIKVDGLEPSVIMNAATDFMV
DMSKVGSNIESGKLSCAIFDPKGHVLPSKMVQGPTDDIFRIMYTPFEAGRHTIELMYDNI
PVPGSPFVVNVKSGCDPTRCKAYGPGLESGLTNQKNKFTVETKGAGNGGLSLAIEGPSEA
KMVCTDNRDGSCDVDYQATDPGEYDITIRFADKHIPGSPFRVLVEGSVDPSKVKVYGAGI
EHGQVRESVPTVFNVDVGEAGPGPIAVKLTNSEGIPVDNLSVEDKGNCIYAVHYVPPKAG
SVLTCQVKFADVEVPCSPFVMTVFPKSEATKVTVKGVNETKKTPASLPAEFEIDTKQAGQ
ADINVAIKNPKGKPMQPRLEEVATGTYVVSFVPDECGTYQCSIKYGDKEIEGSPFKLEAF
PTGEAKKCKLVEEAPKIQPSGSQSHIKVDAREAGNGAVTCKITNKAGSEIVDIDVIEKDG
FFDILYALNDPGDYDINVKFGGKDIPNGSFSIKAVESIEQYSHSEYVEEHTTKVLKQTTT
QSGLVNGKSEVTYRSVAFEKLPLPTTGGNVTAEVRMPSGKVDKPIIQDNRDGTVSVKYDP
REEGSHELVVKYNGEPVQGSPFKFHVDSITSGYVTAYGPGLTHGVTGEPANFTISTKGAS
AGGLTMAVEGPSKADIKYHDNKDGTVSVQYLPTAPGEYQVSVRFGDKHIKGSPYFAKITG
EGRKRNQISVGSCSEVTMPGDITDDDLRALNASIQAPSGLEEPCFLKRMPTGNIGISFTP
REIGEHMVSVKRMGKHINNSPFKVTVCEREVGDAKKVKVSGKGLKEGQTHSDNIFSVDTR
NAGFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVK
VAGEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQ
EIEDGLYSVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERG
VVGEPAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKF
NDRHIPDSPFKVYISPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAP
SGTDDDCFIQAIDGEMSSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVH
ATGNGLDDIKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPG
EHYITVKYNNMHIVGSPFKVHATGDKLADEGAQETSTVIVETVQKIAKGGKSTGVHLPNF
KSDASKVVSKGMGLKKAYVGKQNQFSVCATDAGNNILYVGMYGPKGPCEEFHVKHAGHNN
YNVQYLVRDRGQYVLLIKWGDDHIPGSPFQIDV
Download sequence
Identical sequences B4JY94
7222.FBpp0148160 FBpp0148160 XP_001995998.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]