SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0148775 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0148775
Domain Number 1 Region: 36-279
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.13e-82
Family Calponin-homology domain, CH-domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 2.88e-31
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 3071-3226
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-30
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 4 Region: 2859-3015
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-30
Family Spectrin repeat 0.00042
Further Details:      
 
Domain Number 5 Region: 2220-2380
Classification Level Classification E-value
Superfamily Spectrin repeat 5.69e-30
Family Spectrin repeat 0.00091
Further Details:      
 
Domain Number 6 Region: 693-814
Classification Level Classification E-value
Superfamily Spectrin repeat 3.27e-29
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 7 Region: 1586-1740
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-29
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 8 Region: 584-726
Classification Level Classification E-value
Superfamily Spectrin repeat 7.55e-27
Family Spectrin repeat 0.00055
Further Details:      
 
Domain Number 9 Region: 3786-3896
Classification Level Classification E-value
Superfamily PH domain-like 4.4e-26
Family Pleckstrin-homology domain (PH domain) 0.00042
Further Details:      
 
Domain Number 10 Region: 1802-1951
Classification Level Classification E-value
Superfamily Spectrin repeat 1.37e-25
Family Spectrin repeat 0.00077
Further Details:      
 
Domain Number 11 Region: 3189-3331
Classification Level Classification E-value
Superfamily Spectrin repeat 6.84e-25
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 12 Region: 2755-2899
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-25
Family Spectrin repeat 0.00046
Further Details:      
 
Domain Number 13 Region: 3389-3542
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-24
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 14 Region: 1903-2056
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-24
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 15 Region: 1059-1209
Classification Level Classification E-value
Superfamily Spectrin repeat 1.67e-23
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 16 Region: 1379-1496
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-23
Family Spectrin repeat 0.00056
Further Details:      
 
Domain Number 17 Region: 2009-2164
Classification Level Classification E-value
Superfamily Spectrin repeat 6.12e-23
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 18 Region: 2492-2596
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-19
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 19 Region: 1500-1623
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-18
Family Spectrin repeat 0.00095
Further Details:      
 
Domain Number 20 Region: 2378-2495
Classification Level Classification E-value
Superfamily Spectrin repeat 8.92e-18
Family Spectrin repeat 0.00089
Further Details:      
 
Domain Number 21 Region: 1287-1423
Classification Level Classification E-value
Superfamily Spectrin repeat 1.21e-16
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 22 Region: 970-1065
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000775
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 23 Region: 842-918
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000184
Family SH3-domain 0.001
Further Details:      
 
Domain Number 24 Region: 1219-1320
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000302
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 25 Region: 2670-2752
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000115
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 26 Region: 2600-2701
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000187
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 27 Region: 3516-3649
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000038
Family Spectrin repeat 0.00089
Further Details:      
 
Domain Number 28 Region: 437-526
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000042
Family Spectrin repeat 0.0011
Further Details:      
 
Weak hits

Sequence:  FBpp0148775
Domain Number - Region: 2173-2240
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0345
Family Spectrin repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0148775   Gene: FBgn0020167   Transcript: FBtr0150283
Sequence length 4382
Comment type=protein; loc=scaffold_15110:complement(13731046..13731296,13731903..13732637,13732815..13732922,13732982..13733309,13733379..13739304,13739369..13740979,13741048..13741187,13741247..13744220,13744290..13744477,13744739..13744868,13745024..13745286,13745348..13745464,13746917..13747084,13747156..13747349,13747939..13747954); ID=FBpp0148775; name=Dgrikst-PA; parent=FBgn0020167,FBtr0150283; dbxref=GB_protein:EDV97070,FlyBase:FBpp0148775,FlyBase_Annotation_IDs:GH14869-PA,REFSEQ:XP_001984722,FlyMine:FBpp0148775; MD5=745fe9b65e2a9859f5a3cc28c3cf3d4f; length=4382; release=r1.3; species=Dgri;
Sequence
MTGRQASQYEPGGYSTQQSSSSSTRGNHTAMTQRDGIIKFENERIKTLQEERLHIQKKTF
TKWMNSFLIKAKMEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSL
AFLHTKVRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIVIDVDEENESSEKRSAKDA
LLLWCQRKTHGYPGVNITDFTSSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNH
AFDTAANELGIPSLLDAEDIDSVRPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQ
LMDADRKKMHYERLTTNLLSWIRQKTTELNQRDLPNSLEGIQHELLAFKEYRTIEKPPKY
KERSEIEALYFTINTLLKALNQPSYNPQDGQLVNDIEKAWQILEYAEHKREVALRDELLR
QEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRYLRQVDATLKKHEAISADILARVERFN
DLTAMANELERENYHGKERVKRREQEVMEKWRKLLELLENQRLNLSQMSTLMNLLREIAS
TTESVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNSYGETLKRFNRQAQPYKNSEH
KDAAVLAQRLGQLEQAYAELLKLSAQRRARLEEARNFHHFMEDYDNEESWLVDKQRICKT
GITAKDLRAVLSLQQKHKALEDEIKSRKPKSSQMSEAGKRLIGEHHPRASEIKSRIDSLA
EHWQALESLVELRRRQLEDAAEAYQFYTDANEAESWLNEKMALVNSRDYGNDEPSAQALL
QRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELTAAEPELPELEQEEWVNETRLVP
KEVWEDEWVEKLEHKKVTETKMLPHVRSLFPFEGQGMKMEKGEVMLLKSKTNDDWWCVRK
DNGHEGFVPANYVREIEARPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIRPVSVDPK
PLVQRRTSNQSINENADSVEKRQQRINATYDELQEMAQKRHALLEDSIHLFGFYRECDDF
EKWMKEKERMIKTDDGDGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRQQGHSQLDK
IIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITP
DLKTVQALQRRHQNLERELAPVEEKVNRVTYLGNSVKNAYPAERDNVNAQQQEVQDMWQQ
VQLRGSELRARIESEVGQQIFNNSAKTLLAWIDSVKDQLNADESARDVETANNLLKKHND
LGDDIKAHDNEFVEVIQLGKQLSDGKPNMAETVQLIGRLKAEQDAIHRGWSEKQKWLLQC
VELQMFNREADKIDATTKSHEAFLEYNNLGSSLDEVEAILKRHLDFEKSLMAQDKILKGF
SDNADKLIANDHYDAKYIGERRKQVLGKRKAVKDRAFERKRLLQASKDYHKFAAEADDLK
AWLNDKTRIAGDESYRDLSNLPRKLQKHKAFERELRANEGQLRNVNKDGEALIQAENRVP
EVESLVADLNRKWKELLTLSEDKGRKLEQAASQREHNRAIEDAKKKVNELDSALKSKDVG
NDLRSCKDLINKQQLLESEITIWDQKVAELVSTGDDMAHEGHFNAKNIEDETKELQQRFK
DLRDPTQMRRDKLEESLNFHKFVFELDAEFQWINDHLPAAKSNELGQNLHQAQSLFKKHK
KLEAEIKGHQPMINKALQGGQSLVAQQHPESKNVEALCEQLELAWQDLELHCGERTRKLE
MSLKAQQYLFDAGEIESWLGERNNALRSTEYGRDRDSAAKLLTKHKTIELELDTYSSIVT
EMGHTCAAMVAAQHPDSKVLAAKQQLIEKMLKSLHKLASQRQMRLMESLSKHEYFLESDE
VEQWIREQEQTASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSES
SYANEVEKRQEQLRTSWENLLKLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSS
ELGKDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNAQAIAQQQDKVVA
AWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSANLRAALQAEEHVSDAAGATALKI
QHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKI
MLEQKIDLFCFLRDAKQIDNLSSTQQAALSSSDFGQTVEDVQNQIKKHDEFERVIQTQEE
KVALLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRD
CAESESWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIKEIQDTGV
ILLSKQHESSPEIKQAIERVLAAWQGLLAELDQRGRGLEEAQDILEFNNQLDKIEAWIRD
KEMMVQASDMGRDLEHCSALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQLPADTQS
VDKRRRDFNHNWRQLQGALNAYRALLGGAHEIHVFNRDVDDTAERIAEKALAMSSADTGR
DLAAVEALIRREEALERDMSAVKQKIDEHETAAEFLTRKYPERGAQVIERKLQELHKSWN
NLQSLSVKRQTVLNEAYLTHKFVSDVRELELWVNDMIKKMNATQAPSTINDCETQLELHQ
ERKVEIEGRDPAFVTLKQHGEQLSGQAKQPESVKQYLRVLEELHQTLHEAWTERARDLTE
AHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDAFEKLLDADHVDALQ
KFANSILEGAPKDADLISEKLAYVLRRKQKLLNLSAERKNRLQQSLQLQEFLRSLYEIDR
WLVQKLQVALDENYREPSNLQSKIQKHTAFDAELLSNSPRVQAVISEGERLIKGEHFAKD
EIAQQVQLLGGDWHKLKAASKAKKEKLQQAHEALAFNRSVDEFNNWMDDVELQLSSEDYG
KDLATVSNLLKKHERLEADVAHHNELADQLKLKDEHFFQVDHFLKHDIHERAMSTIKRYN
TLHEPIAIRRENLEDSLSLQQFVRDADDELQWLAEKQLIAGSQDLGSSLLAVQGLQKKHN
ALEAELTSQEPLIQALLQRGQQMIRDNHFASERLQYKSDLLQKQLVQLRDLAAIRRLRLL
DAVESQLFYVEANEADAWMREKRPILASSDYGRDEISVQVHQKKLEVLQRELTSFKPSID
KVNKLATGLIERNHFDSANIQEKNGAVDQQYVELLRLAKDREQRLKESKKLFEYLRETEE
LHEWVGDQMTVTASEDYGEDVEHVEQLMLAFESFVSNLNANEARVEACLEHGDRLIQENN
PYRNSIKAQRDKTKQLWDELNELVNARQDALAGAKRVHVYDRVADETISLINEKDASLIS
EDYGQDLESIQALGRKHQVFEGELIAIKEQVDSVLQEVITLGAIYPDAREHIEVKRDETI
EAWTELNEKADARKGKLNQAEQLQSYFDEYRDLIAWINEMLAKITAPELATSVAGAELLL
ASIKDHHAEIRARDETFANFTANGQKLIKEKHFLAHEVEDKIKVLQSRHELLEHTLQQRK
EIYELNLDTQLFLKDAEILEQWICSREPLLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQE
EKFQAIKRITLLEQRFRKQLEHEKLAKLKEKERLEKERLEQLKQKELQRLNDERRRAEKQ
QEHRNNAAAQEKTPIFSAPMVTPGNSSNISVAPGSASQSPAISQTHLRPPFQDQQSQDEH
AALQKSSSSGMFGDRLRRGSADANVKRAESMKVQPKQAKRTPSFTTRRRAQSFRKNQKGE
GFDLPPVEIQGMLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDDNDFLQQKTAQA
PVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDIMNDWVRKISFHASLPPNLQ
LLSYDESMKQQSSSSPDIKVTSGMESPVSSRNSSPDSQRRSSVQTPNSAEATPQMAFLRQ
MQQKQEYLQYQQTSQPSSPTAGTDQKPPIPPRGAPPVATTRQSQENLVVLRNRQSSSNDI
TDGRLQQSATLPAQNGNSKDDSAVLMRSSESRQSDNPPPLPTTMPPLGSASSHHQKQKQQ
HPQQQHQQHPQQHPHQHSHQSKQVQQRINAFNAAANQQQQQQQHQPDYYNSNIVRQQQQQ
QQHMASPQRVPSLNTGRIDSTRKFIEMETHAPGNIYTHSSTSNNNNNGHSSGNSSSSSNN
TTTTTTTKRTVNYSSSGASSNGNGNIQQKGTNTTTTTTTSSSTTTQQQQQATSSRTVWHL
TSSPTSSTKSSSGSVDHNNAISNPSYMGLHLNNNNDGIGGWGNSRFEGNRPVSLQPDSIS
FTRASAESSSESEAQSISSVSGVKGSKSKEERRSGMFRIFGRKGGDKEKEKEKRRSSQTP
PQ
Download sequence
Identical sequences B4J2I5
7222.FBpp0148775 XP_001984722.1.65300 FBpp0148775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]