SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0151272 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151272
Domain Number 1 Region: 213-514
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.75e-86
Family Cryptochrome/photolyase FAD-binding domain 0.0000246
Further Details:      
 
Domain Number 2 Region: 6-180
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 1.44e-40
Family Cryptochrome/photolyase, N-terminal domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0151272   Gene: FBgn0124836   Transcript: FBtr0152780
Sequence length 539
Comment type=protein; loc=scaffold_14830:join(3116996..3117137,3118335..3118678,3118744..3119663,3120157..3120370); ID=FBpp0151272; name=DgriGH17366-PA; parent=FBgn0124836,FBtr0152780; dbxref=GB_protein:EDV91296,FlyBase:FBpp0151272,FlyBase_Annotation_IDs:GH17366-PA,REFSEQ:XP_001994667,FlyMine:FBpp0151272; MD5=441da0bbdd0465175df6d3b2e0b5fd95; length=539; release=r1.3; species=Dgri;
Sequence
MTLRGANVIWFRHGLRLHDNPALLSALADKDYGIALIPIFIFDGESAGTKSVGYNRMRFL
LDSLDDIDKQLKEVSDGQGGLLICEGQPTDIFRRLHDQVRLHKICVELDCEPIWNERDEA
INNLCRELGIEYVEMVSHTLWDPRTVIDTNGGIAPLTYQMFLHTVHIIGLPPRPVHDPQF
DGVGFVQLSAEMRREIGCLEKTPSPEHFNVYSDNMGTLAKINWVGGESQALLLLGERLKV
EQHAFERGYYLPNQALPNIVDKPKSMSAHLRFGCLSVRRFYWNVHDLFKNVQLRACIRGV
QMTSGAHITGQLIWREYFYTMSVNNPQYDRMEGNEICLNIPWAKPNEDHLQRWRLGQTGF
PLIDAAMRQLLAEGWLHHTLRNTVATFLTRGGLWQNWEFGLQHFLKYLLDADWSVCAGNW
MWVSSSAFERLLDTSQVSCPVALAKRFDPNGVYIKQYVPELRNVTKEFIHEPWRMTAEQQ
EIAECLIGVHYPERIIDLSLASKRNMAAMKALRNSLIEPTPHCRPSNEEEVRQFFWLDE
Download sequence
Identical sequences B4JUX6
7222.FBpp0151272 FBpp0151272 XP_001994667.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]