SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0151576 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151576
Domain Number 1 Region: 126-616
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.65e-162
Family Calponin-homology domain, CH-domain 0.00000000339
Further Details:      
 
Domain Number 2 Region: 7-93,415-447
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000437
Family Calmodulin-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0151576   Gene: FBgn0125140   Transcript: FBtr0153084
Sequence length 639
Comment type=protein; loc=scaffold_15081:complement(1736145..1736345,1736424..1736677,1736772..1737050,1737120..1738230,1749263..1749337); ID=FBpp0151576; name=DgriGH17670-PA; parent=FBgn0125140,FBtr0153084; dbxref=FlyBase:FBpp0151576,FlyBase_Annotation_IDs:GH17670-PA,GB_protein:EDV95263,REFSEQ:XP_001995611,FlyMine:FBpp0151576; MD5=dd246f3f4c9183a371287752878f124e; length=639; release=r1.3; species=Dgri;
Sequence
MATLNKFTKSLSIDEKAEIKEKFTELDANKDGFIDLHELKDALNQVGFKLAGYQVREMID
EFKSKQRTAHQGKLNLDEFETLCLDLKSKDVASTFKTVVSKKENLETLGGMSSISSEGTT
HSVRLEEQLAFSDWINSNLGHDKDLQHLLPIDAEGKRLYQSIKDGILLCKIINHSCPDTI
DERAINKKSLTVYREFENLTLALVSSQAIGCNIVNIDAHDLAKGKPHLVLGLLWQIIRIG
LFSHITLDSCPGLAGLLFDNERLEDLMKMSPEAILLRWVNHHLERAGISRRCTNFQSDIV
DSEIYTHLLKQIAGNEADVNLDALRESDLQSRAEIMLQQAAKLNCRSFLTPQDVVNGVYK
LNLAFVANLFNNHPGLDKPEQIEGLESIEETREEKTYRNWMNSMGVAPHVNWLYSDLADG
LVIFQLFDVIKPGIVNWSRVHKRFTPLRKFMEKLENCNYAVDLGKQLKFSLVGIAGQDLN
DGNATLTLALIWQLMRAYTLSILSRLANSGNPIIEKEIVQWVNTRLSDAGKESKLKNFND
PAIADGKIVIDLIDAIKEGSINYELVRTSGTQEDNLANAKYAISMARKIGARVYALPEDI
TEVKPKMVMTVFACMMALDYVPNMDSVDQNNHNNSNNSN
Download sequence
Identical sequences B4JWY7
FBpp0151576 XP_001995611.1.65300 7222.FBpp0151576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]