SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0151601 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151601
Domain Number 1 Region: 33-209,255-365
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-44
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0151601   Gene: FBgn0125165   Transcript: FBtr0153109
Sequence length 367
Comment type=protein; loc=scaffold_15081:complement(1236344..1236779,1236865..1237049,1237184..1237455,1237525..1237614,1238060..1238180); ID=FBpp0151601; name=DgriGH17695-PA; parent=FBgn0125165,FBtr0153109; dbxref=GB_protein:EDV95209,FlyBase:FBpp0151601,FlyBase_Annotation_IDs:GH17695-PA,REFSEQ:XP_001995557,FlyMine:FBpp0151601; MD5=4d1302bd1cacef8b81aa48af2c94fa9d; length=367; release=r1.3; species=Dgri;
Sequence
MSTLNRPKSPHTPTTIKKGEKEDSFWDKFSTLGRKRGTREVKKVQEEGKYAIDSPGSPSQ
FDIPPEDYALREHEQRAVIDPQSSNDPEVLKLQQILIDWINDELAEQRIIVQKLDEDMYD
GQVLHKLWEKLTGKKLDVPEVTQSEQGQHEKLNIVLSAVNHTLGFHQKIPKWSVASVHSK
NIVAILHLLVALVRHFRAPVRLPENVFVTVVIAEMSAGFMNAQKYQEQITSEYDDLGMRC
EKDAFDTLIDCAPDKLAVVKKSLITFVNKHLAKLNFEINDLNTDFRDGVYLCLLMGLLGG
FFVPLHEFHLTPQDPDQMVNNVAFAFDLMQDVGLPKPKARPEDIVNMDLKSTLRVLYSLF
TMFRDYA
Download sequence
Identical sequences B4JWT3
XP_001995557.1.65300 FBpp0151601 7222.FBpp0151601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]