SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0151832 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151832
Domain Number 1 Region: 36-272
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.35e-88
Family Calponin-homology domain, CH-domain 0.00000398
Further Details:      
 
Domain Number 2 Region: 578-738
Classification Level Classification E-value
Superfamily Spectrin repeat 2.03e-35
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 3 Region: 291-412
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-34
Family Spectrin repeat 0.0000925
Further Details:      
 
Domain Number 4 Region: 1860-2015
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-29
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 5 Region: 2148-2256
Classification Level Classification E-value
Superfamily PH domain-like 4.76e-27
Family Pleckstrin-homology domain (PH domain) 0.00000437
Further Details:      
 
Domain Number 6 Region: 809-948
Classification Level Classification E-value
Superfamily Spectrin repeat 5.66e-27
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1490-1592
Classification Level Classification E-value
Superfamily Spectrin repeat 1.68e-25
Family Spectrin repeat 0.00032
Further Details:      
 
Domain Number 8 Region: 1668-1802
Classification Level Classification E-value
Superfamily Spectrin repeat 3e-24
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 9 Region: 1223-1376
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-24
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 10 Region: 1009-1129
Classification Level Classification E-value
Superfamily Spectrin repeat 1.92e-23
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 11 Region: 1139-1256
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-22
Family Spectrin repeat 0.00082
Further Details:      
 
Domain Number 12 Region: 1595-1698
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-22
Family Spectrin repeat 0.00058
Further Details:      
 
Domain Number 13 Region: 740-842
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-20
Family Spectrin repeat 0.00057
Further Details:      
 
Domain Number 14 Region: 376-521
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-20
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 15 Region: 1386-1485
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000461
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 16 Region: 2019-2081
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000209
Family Spectrin repeat 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0151832   Gene: FBgn0125394   Transcript: FBtr0153340
Sequence length 2291
Comment type=protein; loc=scaffold_15081:join(3156268..3156729,3156953..3162539,3162612..3162808,3162913..3163081,3163671..3163777,3163888..3164054,3164129..3164315); ID=FBpp0151832; name=DgriGH17926-PA; parent=FBgn0125394,FBtr0153340; dbxref=FlyBase:FBpp0151832,FlyBase_Annotation_IDs:GH17926-PA,GB_protein:EDV95404,REFSEQ:XP_001995752,FlyMine:FBpp0151832; MD5=3c97d8df5d381361795ac7ad16163cbf; length=2291; release=r1.3; species=Dgri;
Sequence
MTTDISIVRWDPSQGPGNEYIDEYEYDGGNSSSRLFERSRIKALAEERESVQKKTFTKWV
NSHLCRVNCRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLR
EQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQ
MKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDK
LGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMI
HDYEHFTSDLLKWIETTIESLGEREFANSLVGVQGQLAQFSNYRTIEKPPKFVEKGNLEV
LLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLA
ARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVEAVVAV
CDELESERYHDVKRILLRKDNVKRLWMYLLELLRARRMRLEISLQLQQNFQEMLYILDNM
EEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDDPESYKP
CDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVST
DEIGHDLTTVNLLLSKHKALESEITSHDPQLQNVAKVGAELITEGHFGADRIKDRLKEIL
SKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLL
KKHKDVAEELKNYAEVIDALHKQADTLKLNEPEKASVDKRLEAIDSRYKELTELAKLRKQ
RLLDALSLYKLMSEADGVEQWIKEKTKMLDTMVPGKDIEDVEIMKHRFEGFDKEMNANAS
RVAVVNQLARQLLHVEHPNSDEILDRQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIE
CRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLGREADSIE
VEHPEEAQLIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQIWLTKTQT
DVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKSMMEYGERLTSEGNTSEDPQYMFL
RERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVN
LEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKEHFDADKIGKRAENITGRRDDN
RQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYVTSQDETYRSAKTIHSKWTRHQAFE
AEIAANKERLYEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGALLFDAN
REVLVQQTCDDIDSYITDLERQIVSGDTANDLTSVNILMQKQQVIQTQMAVKARQVEEID
KQTEYLQKTVPEEKIEPIVVKKTAVLERFEKIKAPLLERQKQLEKKKEAFQFCRDVEDEK
LWIDEKLPVANSSDYGNSLFNVHVLKKKNQSLATEIDNHEPRINAICNNGRKLIDEGHED
AKKFEALISDLTAKWQELKDAIDNRKKHLLESEKVQQYFFDAQEAESWMSEQELYMMVED
RGKDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSSDDVSSGDAVAVKQSQLDKL
YAGLKDLAGERRARLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDYDHVTLLSER
FNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDSLNESWQDLLELIETRTQ
MLAASRELHKFFHDCKDVLGRILEKQHGVSDELGRDAGSVSTLQRKHYNFLQDLTTLYSQ
VQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNM
VRILTIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFSACISLGKELLT
RNHYASADIKDRLKSLNNSRNALLLRWAERWENLQLILEVYQFARDAAVAEAWLIAQEPY
LLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFELKEMKRRQEMAEEAER
HRIKEEQEAKAASEAAELAKREAERRDDVDVGVSHDEAERGATPASGDGQEGYVTRKHEW
ESATKKASNRSWDKVYMAARAGRVSFFKDQKGYKSNPELTFRGEPSYDLQGAAIEIASDY
TKKKHVLRVKLASGAEFLMQAHDDNEMSQWVSALKAQSESAAVAASRSQTLPATSQKDEP
KRRSFFTLKKK
Download sequence
Identical sequences B4JXC8
FBpp0151832 7222.FBpp0151832 XP_001995752.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]