SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0151859 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151859
Domain Number 1 Region: 424-667
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.62e-29
Family Calponin-homology domain, CH-domain 0.0029
Further Details:      
 
Domain Number 2 Region: 125-278,416-500
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.31e-18
Family HI0933 N-terminal domain-like 0.097
Further Details:      
 
Domain Number 3 Region: 1077-1107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000491
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  FBpp0151859
Domain Number - Region: 1108-1139
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000314
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0151859   Gene: FBgn0125421   Transcript: FBtr0153367
Sequence length 4784
Comment type=protein; loc=scaffold_15074:complement(4086500..4086771,4086831..4086931,4087066..4087143,4087208..4087412,4087534..4087801,4088933..4088965,4089476..4093534,4093601..4093759,4094312..4094333,4094771..4099929,4100101..4100216,4100277..4100703,4100782..4101042,4101757..4102299,4103303..4103578,4104226..4104287,4105012..4105520,4105588..4105720,4105786..4107457); ID=FBpp0151859; name=DgriGH17953-PA; parent=FBgn0125421,FBtr0153367; dbxref=FlyBase:FBpp0151859,FlyBase_Annotation_IDs:GH17953-PA,GB_protein:EDV94744,REFSEQ:XP_001994008,FlyMine:FBpp0151859; MD5=b3a40fc35f340828bd04a85037cb535d; length=4784; release=r1.3; species=Dgri;
Sequence
MSRQHQRHHQQQLQQQQLQQQQQQQQQLLTAQQQQQQALLMAEHAAAAEAAELFNLLCVA
TTMRQILALHRAMCEAVGLRPSPLNEFYPKLKAKVRSWKAQALWKKFDARAAHRVYGKGN
ACTGTRVLVIGAGPCGLRTAIEAQLLGAKVVVLEKRDRITRNNVLHLWPFVITDLRNLGA
KKFYGKFCAGAIDHISIRQLQCMLLKVALLLGVEIHEGVSFEHALEPSEDHSGWHAAVTP
ADHPVSHYEFDVLIGADGKRNMLDFRRKEFRGKLAIAITANFINKKTEAEAKVEEISGVA
FIFNQAFFKELYSRTGIDLENIVYYKDETHYFVMTAKKHSLIDKGVIIEDMADPAELLAA
ANVDTQKLHDYAREAAEFSTQYQMPNLEFAVNHYGKPDVAMFDFTSMFAAEMSCRVLVRK
GCRLMQCLVGDSLLEPFWPTGSGCARGFLSSMDAAYAIKLWSNPQNSTLGVLAQRESIYR
LLNQTTPDTLQRDISAYTVDPATRYPNLNRESVNSWQVKHLIDTDDPSILEQTFMDSHAL
NLLPNVQTPGKRKRRSGDSLPQAASLLRWISVQLATHHFAAELKEPSDVFRNGRVLCALI
SRYRPDLIDYAATKDMSPLECNELAFAVLERELHIDRIMTAKQSMDLNEVESRVWLNYMD
QICEQFRGEIPHIKHPKMDFSDLRQKYRINHTHAPPDFSKLLQTKPKAKSPMQDAVDVPT
TVQRRSVLEEERAKRQRRHEQLLNSGGGNLAANSATAAAASGAASSNNVQQAQSDTPRRS
KKRRQADKTANIEERQQRLQEIEENRLDRMSRRRQQRFHQTQNFYKSLQLLQAGKLLREG
GDGVTEGVAEDGTPFEDYSIFLYRQQAPVFNDRVKELERKLLFPDRERGDIPSALPREAD
QQFSDRIKNMEQRMTGRPGQGSDKKPKDLMRAIGKIDSNDWNVREIEKKIELSKKTEIHG
PKGREKVPKWSKEQFQARQHKMSKPQRQDSREAEKFKEIDTTLKNLDKQLKEGHNLDVGE
RGRNKVASIAGQFVKKDETNSDEKNASSNATTNTTTTTNTVIPKSSSKVALAFKKQAASE
KCRFCKQTVYLMEKTTVEGLVLHRNCLKCHHCHTNLRLGGYAFDRDDPQGRFYCTQHFRL
PPKPMPQRINKRRSAAAQPATPASPATPQAAPTPTAETAVEAMDTTPTRDQVDLLETSRA
AASADNMSDDEANVIDENEWSGRNFLPESNNDSQSELSSSDESDTESDSEMFEEADDSPF
GAQTLQLASDWIGKQYCEDSDDSDDFYDSSEGIADDGKDDTEGEEFKKARELRREEVRLQ
PLPVNLPTDTETEKLNLNIENKENVERSSLKSANSFESAKSQPTTPTATPTRAQIEQLER
NEPRKFSSEIEAISEKLYHLNNMVKMNKDLEVLAKENLVKSDILRKLTLKEKWLAENAAI
AAGMKVTPTPTIAAPSKSTFDEKYEKVVSPPKTVVAEPKPKPVIDFNLDELKPRKPNFEE
RPKELLVKPESLKKATQLSPKPESKSSANVSRSSSIKSNASSKSSPRQRKSHMENLLGTL
KKLQRQHSSEQDEEMDIDDDVESQTNPQLNSKLKEIGASTFAGTMDHIKSQMVTPTVHTA
SVDLSKYFPNQKPEKSSAGNTNKNQKTLKDVDLAKYFPSSPAPQRRTVETVADRLKRSQT
EASVPQPEKVENPKDTKDTQSKTEPKSKPLAPKRQSSLNTFSLREHQLDGAMDLSKKKAP
VKLVVQGKPAEKKVTTTTVAKATTTPKGKIKIVKKIVPKGTKAKKAAAAAAVAATSKTET
KPEEEQLPRDEAERILDEILADGGETRSPSSEYQKLFNDDKSPSDLSDKIERILEETGLD
LELGLPRRQSKKLLKTKSLGEGEFDLEPKQRLSGVQNILKRFESMSSVHSQNSDEQGAFK
LRRMESSTSNLSSLNRSRESLASVTDSMSDLERTMDYLRNEWRSEATNFLQKKRNKFYAE
KDEQQKQLQQEQERKPEPARGIELPVQYHDSKLAKFFGLAPRKSPEKRKSPIKKKKSPKP
TKANNSLEELAKISNARQAKQAQQKQNKTTVKIKKIEPKIELIPPKPATPVPDDFEILDL
IEKATEAKELERSKTKSPLVEEILDEILNLDAATDDTPVRPAAEDIRNLPKTGCDKSLNN
SRRGSQSSLVLSRRQSDISLTEKLNQEALQALSSIELERDVEHVDEVFQSMVEAMECQSQ
VQVTDLDDDIDADSLCTTISKSPSAQPITVVKRGSSEDHSIEKLFGEFSDKMLVNVDFDS
NDDLVGISPRVDLMANSSAERDFLGKLESLERDEVSESQRDEALESRVNQPNRFKHTENQ
GVDEVDGSHFPSRPQRRQKSSSSSSEPNIPVPPQRLKKKLAKLDPEDMPPSVQDLLQQLH
TKNVEMRTQSTLVVENPKFPRLQPAEDVVDPVKKAPKDGNSVSQPKPRDEIPVPEIQIDQ
AEPPKPESQNGSIKSTNSSHNSLNEPRKLITPSKSDNSLEWNMEMLPNSPMPRRKQPLIP
PSKESSLEWDMEKLPNSPMPLRRRLPAAVAPAAAAATDVSPISSIQLLNNLPSVEDNATA
AQERIIKEFERERRQALIKRDENFEAAAAEQRRRDSQQSSSNSSGTSIGKRSLPPPTLPQ
TPTQRRAATQASNNGSRRESIKRDGSPPMFKKLDLGDDGISTVDSTADSTRRSSFAFIVL
QDNKPVIVPMPKKLQLPKLEPSKYVPEVSAADEPVPEVFKDRAWPNQHSIEVVEIDDEEE
AEQALKEQLPEYARSDSPPSAAFQNRQWPDGRTRFEQQQRNDSLEADDVLGLMSTKRRNH
KRFINKPRSQSPQSFKPLSASARQSSKSYSDLKTGDSISASLQSLGSARSSQDTTDSRST
ATTVASPRPLNYVNYDDPVDATTKALLDRSKRLHNRKRDFVNERVVERNPYMRDVIRSNY
EPEEELSGYRPRNYTSGLTTANTATNRFPSANTSSIRNTRNYDYLSNNSSSDYLSRRPYS
ASTMATSSYLPYTTTASSSSHLSDLFRRRSPASSSNMSSYGLPASKESCVISYVWVRSMK
VQTESESTSPDEVELNSATEISTDSEFDNDEIIRQAPKIFIDDTHLRKPTKVQIKSSMIT
ASASGLHQKQLASREKGGSYLQKYQPQPPLPQFKPLVQVDPTLLIGSQRAPLQNPRPGDY
LLNKTASTEGIASKKSLELKKRYLLGEPANGNKIQKSGSTSVLDSRIRSFQSNISECQKL
LNPSSDISAGMRSFLDRTKLGDSTQNELMRSATSNVINDLRVELKIQKAPSSNSTDNEKE
NVFVNSKNELNKGMEYTDAVNATLLDQLNKKTSPTTPTSNKTIVEVIDLITPEKPVPFID
LTVLETPKMKTTSDAIINPELNVAVVSALMPDSNKINDLKPDVSKDVKECIPDILGDIKA
AKEAAGAADEEEQQSLICQSDEEKRDSPEKVNYLEQEDSLQIQVPNIPWTKPKSEIISTT
GSSATSCSSSDSSSIEDIQHYILESTTSPDTQTAGGGKHNVPRVEVHDSSGALMQVDSLM
IVNGKYIGDPEDVKFLDMPAGVIVPPVVAAIKTSELDDDHDAEVEPVTATPEPAECTVIE
AERQLVSTPPALPEMGPPKLKFDSKNENKIETLKNLPLIVERQPEHSQVVKPITLNLSSS
AAAKTPDTPTTPTQHDSDKTPTGDLHSRGSDSETEHTGTGQVFTETELSDWTADDCISEN
FVDMEFVLNSNKGTIKRRKDHRRRHNQQSVTAKLPSSTEVLHELAKQAPVAVMGGILHAI
DIDDIEFMDTGSEGSCAEAYSATNTALLHNRGYMEYIESVPKQTTEQKTVASQTNAQPLQ
PLLTKRDEKLGIDYIEQGAYIMHDDAKTPVNEEPRLMTQSLTDSSTLNELDDDSVGCMVT
SQTQPTTTEESEALTVVTSPLDTSSPKVLDQFATLLASGKAEISTPSSSEQQPKTTQSTV
TTISSNSSSTPAPAVAAKESEEDIQIQFEYVRALQQRISEISTQRRKSSKGDAPNLQHQP
QSTVIEATAAAAATAAKEEDQESAVTMRPRSSSSSSKVPEIPTLNSKLEEISKERTKQKD
LIHDLVMDKLQSKKQLNAEKRLHRSRQRSLLTSGYASGASLSPTPKLAAASSSSDANCSS
QAHYHVSTAVVEQQPSSPIIETFKPPNPLQKSATASYVSPYRTAQPAVRSSDLYKSRPFS
EHIDAEQFNLLERHKLNKTASFSYGKVDEFTTPMAPLRPHRNGNPTKVEVSISASTENLR
SEARARARLKSNSELGLSPEEKMQLLRKRLQYDQNSAIKAKQQEAISGDLTARARKMSAS
KSVNDLAYMVSHAQQQQQQQQINRLDSEAKAADFTSDPNLAAGAQNKPLKSTKSSRRQKD
PERRKSLIQSLSSFFHKGNSSTTTTSTTSSSSPKEQGVAVAASYSEHAERPGTSSSGTPT
ISDAGSGGGGVFSRFRISPKSKEKSKSCFDLRTFGGGDKDMITNNATSTMTSTTATISQT
TKHTQNYPNNTTNNSRYRKQANTESFSSSSPQLYIHKPHHLVGANAQDDQTPPPIPPLPL
NYQRSDDESNANETREHKKQRAISKASRQAELKRLRIAQEIQREQEEIEVQLKELEARGV
LIEKALRGEAHNYENLDATKDNDEKLLKELLEIWRNITALKKRDEELTIRQQELQLEYRH
AQLKEELNLRLSCNKLDKNYADVAAEGAILNEMLEIVAKRAALRPTASQVDLTAASAAST
STEAGITLAGQSHEQDESNASLQISRIPSSFHRIIIDYPIHFQI
Download sequence
Identical sequences B4JSK4
XP_001994008.1.65300 7222.FBpp0151859 FBpp0151859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]