SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0152353 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0152353
Domain Number 1 Region: 722-1023
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-45
Family Calponin-homology domain, CH-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  FBpp0152353
Domain Number - Region: 1635-1745
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00223
Family Motor proteins 0.015
Further Details:      
 
Domain Number - Region: 1801-1897
Classification Level Classification E-value
Superfamily ARM repeat 0.00485
Family Plakophilin 1 helical region 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0152353   Gene: FBgn0125915   Transcript: FBtr0153861
Sequence length 1982
Comment type=protein; loc=scaffold_14906:complement(5403561..5403833,5403895..5404196,5404258..5409226,5409291..5409503,5409615..5409791,5409858..5409872); ID=FBpp0152353; name=DgriGH18447-PA; parent=FBgn0125915,FBtr0153861; dbxref=FlyBase:FBpp0152353,FlyBase_Annotation_IDs:GH18447-PA,GB_protein:EDV93118,REFSEQ:XP_001990056,FlyMine:FBpp0152353; MD5=3f363d35bf6afeb9eb5a633eb1c0cd75; length=1982; release=r1.3; species=Dgri;
Sequence
MSAFEVTVTPSRLKQKKRIEGREPAVVVMAPFSAKAIVQFEDVPITKTAKRIVRVLNPSD
DDIEVKVTKAIREEHNLSLEWMEKTVPAFDEVSMELVWNPQLEIACKETLQLVDNRNFRK
DVMIILKSKCNQPARTTRKFPTVGKTLHLKSPTGNSSKTHKTLAATANHHKRRMSMSSAA
AASSSSSSTVIKQSVAVRAVNRWSTAETKAPLSERNAFKAAPPTRDAFEVKSFLSPKERQ
CKENVSPMTPANVFNLIDNMQFTPMTEKIGAAAATPLPDNLAAWPTPTLSIKSTHTRIAN
VELQPRRLGSALDDEQNLRTVNETFDVKRADVIEISVDTLDYSRTDQLLQTPTQVLNKTT
TIVHGTQTRALACIREEDVSPPQFLTESPTKLPSGKVHDLKRDINVIGSPLRKYSESMKN
LSLLSPQSKLGIQGSMPNLNEMLLPLRSIEQNRYFQQQAATAPQQPSYSKKLTVPSPNSS
CSSEASTVSHPDMLFNQCEILAQSSRFNLHEVGGKQANSKPQEDVKQAISGQKRRSHELS
FSDAPSNESLHRNETLTISPPKRQRFDASNLAPANASARAAKVWPRAQPKKFKLAQTMAL
LKKPATPRKMREQPATKLYDSDLYMQTCINPDPFAATTTADPFLASTMYLDEQAVERHQV
DFRKWLNALVSIPADLDADTNSKIDVGKLFNEVRNKELSLAPTKEEQSMNYLTKFRLESL
RRAAVQLFFSEEMRLPCSKVAVYVQKQALRIRSDRNLHLDVVMQRTILELLLCFNPLWLR
LGLEVVFGEKLHLQSNRDIVGLSTFILNRLFRNRSEEQKFSKAYTLTEEYAETIKKHTLQ
KILFLLLFLDLAKQRRIIKHNPCLFVKKSPHKETKEILQRFSSELLANLGDITRELRRLG
YVLQHKQTFLDEFDYAFSNLAVDLRDGVRLTRVMEVILLRDNLTQQLRVPAISRLQRIFN
VKLALGALRDAQFELSGDISAADIVDGYREKTLSLLWQLCYKFRSPKFHAAACVLQQWWR
RRWLYVFMRRRIRERAAIRIQAAFRGHQMRKYCKLYRVQRLQAVIVLQKYTRRYFAQKRL
FLIYHSVVTIQVWWRAQRLGRQRRQHFRHLRQSAIFLQRIWRRRIFARKLLAAAQTARLQ
RDQKHQAAAACIQMHWRAYRLGKEQRRRYLRQQQLIVFVQRYVRSKWQMQHTRNQFLLLR
QSTLVLQRRYRARLHMLQARRSYEQKRECIISLQRRWRAKLEMRRQLKCYRDLKRVTTLL
QIKYRARIQMRLQRQEFVQLKAAAVVLQRRYRARLEMLRAQRNYAKDRQSIINLQRRWRA
TLEMRRQRHHYRQLKICSSWLQSKQRARMQMRRERHNFIQLKQATVILQQRWRARQLMHS
QRQQFQQLRRVTINIQRRFRADKAMRFLRAKYRGTQTAVSCLQLHWRNYLLSKSQRQAYV
ELRLAAINVQRRYRAQLEMRRQRNSYQQLKLATIQVQRRYRAQLAMRKQRQEYQNQRALI
VQIQQRYRAKLAMKTARQVYQRQRQAAISIQRRWRALLQMRLQRQNYQRMRNSSIILQRK
WRATLEAQRQRQIFRQTVAKVRLLQRHVRATLLMRQQRQQYQHQRQAALILQRRFRARQT
MLVARAHYQQLQSVTIWMQRKFRATRSMRQKRSEFLQLRRITIHLQQKFRGKRLMLQQQE
QFRLLTSSIVDFQSRLRGYLARMRFQALMTPEMIEYLRQKRAAKVIQRYWRGYRIRRRQR
HAGLIAIRKRLLHLRHQATAMNSVRAKVQDAVRILRGRFIASDALTVLNQLDRISRTVPH
TLMCCSEFMSTFCYGIMAQAIRSEVDKQLIERCSRIILNLARYNSSTINTFQEGGLVTIA
QMLMRWCDKDSEIFNTLCTLIWVFAHCPKKRRIIHDYMTDTEAIYMVRETKKLVARKEKM
KQNARKTSASVIGRHGQQTPNFSPRALPSLQPDFGIIRSSPYTFISSVFAFDTILSKLNI
NV
Download sequence
Identical sequences B4JEI7
7222.FBpp0152353 XP_001990056.1.65300 FBpp0152353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]