SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0153637 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0153637
Domain Number 1 Region: 13-126
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.62e-37
Family Calponin-homology domain, CH-domain 0.0000124
Further Details:      
 
Domain Number 2 Region: 158-217
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.000000719
Family EB1 dimerisation domain-like 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0153637   Gene: FBgn0127195   Transcript: FBtr0155145
Sequence length 243
Comment type=protein; loc=scaffold_15245:complement(17797304..17797896,17797988..17798126); ID=FBpp0153637; name=DgriGH19731-PA; parent=FBgn0127195,FBtr0155145; dbxref=FlyBase:FBpp0153637,FlyBase_Annotation_IDs:GH19731-PA,GB_protein:EDW02704,REFSEQ:XP_001987837,FlyMine:FBpp0153637; MD5=2253168836366244a9cc22bce421c59f; length=243; release=r1.3; species=Dgri;
Sequence
MSKTSDMKPTVSLTSVNAENLSRHQMIEWVNTMVNGNFKKIEEMSSGVAYCQMMEMISPN
CINLKRVKMSAKLEHEFFHNMKLFQGAFGRLKMDKTVPLDRLIKGRFQDNFEFLQWFKKF
FDSQAPGLENIRSAANAVQPKPIVRPRAAIAKDEPTHELQATIEELNTKITDTIEKRDLA
YEKLHKIEMLLTDMINKNEHVDFCNRMLEVLYKTDQNENVNDNVAPEDNSTDSAIDDVNE
GMY
Download sequence
Identical sequences B4J4J9
7222.FBpp0153637 FBpp0153637 XP_001987837.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]