SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0154387 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0154387
Domain Number 1 Region: 1560-1697
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.65e-59
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.0000149
Further Details:      
 
Domain Number 2 Region: 199-291
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000458
Family Calponin-homology domain, CH-domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0154387   Gene: FBgn0127944   Transcript: FBtr0155895
Sequence length 1704
Comment type=protein; loc=scaffold_15245:complement(7606247..7606391,7606460..7606742,7607975..7608037,7610019..7610123,7610755..7610826,7611090..7611164,7611799..7611997,7612065..7612301,7612361..7613971,7614381..7614527,7614878..7614979,7615067..7615421,7615491..7615620,7615692..7615838,7616001..7616063,7616858..7617061,7617452..7617556,7618940..7619092,7620133..7620233,7620312..7620562,7620754..7620889,7620950..7621038,7621103..7621414,7625908..7625937); ID=FBpp0154387; name=DgriGH20481-PA; parent=FBgn0127944,FBtr0155895; dbxref=GB_protein:EDW01391,FlyBase:FBpp0154387,FlyBase_Annotation_IDs:GH20481-PA,REFSEQ:XP_001986524,FlyMine:FBpp0154387; MD5=7630899444043289c60252a4a8699526; length=1704; release=r1.3; species=Dgri;
Sequence
MDAETQEIRQARQRASVKWLLSKAFNNRVPDNLKEPFYRDHENQERLKPQIVVDLGNATI
YCQTLSNLYSDPNYQSLNHWSILQTLARKGVPVAESSDMPITETVLIQTNPLRINAHMSV
IESLMVLYAKEISSGDRVTSAIRRISGSNYQVPPGQNYEHGLLAWISHACASLKKRIVKE
LESSVPDEIGTRLQTPDIPPVRDFQDLCDGICLALLISYYCPKVVPWTSVRINYLPAVED
SIHNILLVSSFSQKHLPYGVFHMTPEDITYMRGSMKLNLVLLLTDLFNLFEIHPAKCVCY
PGMDGQEVIARRHLGANEHGICHRRGLTMPPVTPIPDLRSDLDQPPIGSPSNRPPFQVPP
TNSFSGGLNRRTTPPTEYQTMQSNHFDGNPGEAFVVHKSRGITTLSSMHSQQQQQQQQHQ
QQQQQQYQQQSQQQQQEPLVPARLRQAKEKNNVESKADERGDFVAAGRPSNWEQSRRPSF
AGRRSRRNSSSEDSQLTIENFGGSQDQLNTLGTRYERERDRERKLSNTSVEPAVAVRSSV
ADARGTLQLGYDTDSGSEKQDRETEKYSMRRQASADNVPTVSAHNLSNAGSPLPARNKQH
SIDRDYSHAHEHFNDARSTGYDPESTPVRKSSTSSMPASPAAWQLEICDDDLRSIENATK
LSTMRMKLEERRRRIEQDKRKIEMAVQRHQEKEDLESCPDVLKWETMSNESKRTPEIDPA
DMDKYQQSIAIMNMNLQDIQQDIHRLATQQSQMQAQHLQAQQLMQAQQIANMLNQAFNAP
VSAYNSRPPSRDPYQQQQQQQQQHHHPQPMQMPPMQYVNEHGQYMSPPAHYMQPQSLYSD
NGAPYNHSPYGAAPPQPQYQQHPQRNSVYDEYGQPANHFYLHESPQQPPPQHSHPQRRTW
AHSAAAAAYEQQQQQQQQPLLDVNAWQTQKKMHQQQQQQQPNWPNRPPSSAGASQGFVLH
QNGGGGGGGGGGELQHLFQMQSSPQHVQRMQSVSGNSNGVQRQQSLTNLRDNRSPKGANM
GQMGQQQQQQAMAMAMGQHEDMMAPQSICFIGDEEDVDELERNIIESMQSTRISDFVVQQ
QQRLHQQQQQQQMPAAHSGRGSSSEDYDSGELISNKLNITSGNLTYRIPSPSRPSIQANS
FQDPRGGGGGGSGGSGEEQQAEKGFYISFDNDQPKRPKPPLRAKKSPKKEPGRDLVDNQV
VFKRESLSQLHNINNNNAFAAGVTPGNATYNKYTDEPPIQLRQMAVSAAEPAGMASERRH
LEDLTNQPQQQQQLQQQPLSPSRLRAEHSSSSAEAAKNKALVIGVDTANLDPDSVDEMER
RKEKIMLLSLQRRQQQEEAKARKEIEGSQKREKEREKEEERARKKEEQVARRAAILEQHR
LKKAIEEAEREGKVLDRPDLHVKLQPQSSNASTPRLRQQRVTRPRPKTIHVDDASVDISE
ASSLSSRGKKGSSSNLTGYGQLSSNSMKRDFYRGSQDSLTVKESPDDYPSTSSTPIGRRG
SYKTSREPAVERGRTLSRISVAKGSTLNFRGRKSNSLMNLCDSGLGRATPPRRAPSPGMT
ATGPKLYKQPAAKSNRGIILNAVEYCVFPGAVNREAKQKVLEKIARSEAKHFLVLFRDAG
CQFRALYSYMPETDQVTKLYGTGPSQVDEVMFDKFFKYNSGGKCFSQVHTKHLTVTIDAF
TIHNSLWQGKRVQLPSKKDMALVI
Download sequence
Identical sequences B4J9B0
FBpp0154387 7222.FBpp0154387 XP_001986524.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]