SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0154615 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0154615
Domain Number - Region: 28-73
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.034
Family beta-sandwich domain of Sec23/24 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0154615   Gene: FBgn0128172   Transcript: FBtr0156123
Sequence length 171
Comment type=protein; loc=scaffold_15245:complement(4200784..4201278,4203170..4203190); ID=FBpp0154615; name=DgriGH20709-PA; parent=FBgn0128172,FBtr0156123; dbxref=GB_protein:EDW00987,FlyBase:FBpp0154615,FlyBase_Annotation_IDs:GH20709-PA,REFSEQ:XP_001986120,FlyMine:FBpp0154615; MD5=2e2f3f00c1be13304c1a186ac27e66a7; length=171; release=r1.3; species=Dgri;
Sequence
MCSLKHQFYTLAVALSVGLLGLVSALPQRLQYQPQYQQQQYQQQQVQQLQDVPHTLLDIE
TPNQFSYNSPLAQPDSLRSKPYFDFLSTLYAHDSAKTDLFRNRPRRDLQSELKTQQPLAV
AAAADRPVSHRRERKRRAIVFRPLFVYQQREIKKKEIAARRRSDETRRRRY
Download sequence
Identical sequences B4J6Z9
XP_001986120.1.65300 7222.FBpp0154615 FBpp0154615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]