SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0155198 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0155198
Domain Number 1 Region: 275-520
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 8.24e-66
Family Cryptochrome/photolyase FAD-binding domain 0.0006
Further Details:      
 
Domain Number 2 Region: 91-281
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 9.55e-46
Family Cryptochrome/photolyase, N-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0155198   Gene: FBgn0128754   Transcript: FBtr0156706
Sequence length 530
Comment type=protein; loc=scaffold_15245:5992404..5993996; ID=FBpp0155198; name=DgriGH21292-PA; parent=FBgn0128754,FBtr0156706; dbxref=GB_protein:EDW01185,FlyBase:FBpp0155198,FlyBase_Annotation_IDs:GH21292-PA,REFSEQ:XP_001986318,FlyMine:FBpp0155198; MD5=85d5e9e62968268c9c45e091805ec02b; length=530; release=r1.3; species=Dgri;
Sequence
MKRTKTRSAAGAGKKKLIKDESSSDDEETVQVQSPTEKSKLSYKNFEQFISHMQEQRIAS
ASNVHEFAFRKRRVHVLSNAADVKEQCKGGVVYWMSRDARVQDNWALLFAQRLALKLELP
LSVVFCLVPKFLNATLRHYMFMLGGLQEVEQQCRDLNISFQLLLGPAVERLPAFVVAEEI
GAVVCDFAPLRLPRQWVTDVVKALPRNVPLTQVDAHNIVPLWVTSEKQEYAARTIRNKIN
SKLSEYLTEFPPVIKHPHGNGQKDKPVDWAAAEALLTCDRSVDVVDWAKPGYTAGSRQLY
EFCTRRLRYFDEKRNDPTADALSGLSPWLHFGQISAQRCALEVQRYTSMHKASADAFCEE
AIVRRELADNFCYYNEHYDSLKGLHDWAYQTLQEHRTDERNPCYSLEELEQSRTYDDLWN
SAQLQLVKEGKMHGFLRMYWAKKILEWTATPELALEYCILLNDKYSLDGRDPNGYVGCMW
SIGGLHDQGWRERAIFGKIRFMNYQGCKRKFDVNAYVMRWGGKVHKKQEK
Download sequence
Identical sequences B4J848
XP_001986318.1.65300 FBpp0155198 7222.FBpp0155198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]