SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0156203 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0156203
Domain Number 1 Region: 32-259
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.3e-61
Family Calponin-homology domain, CH-domain 0.000037
Further Details:      
 
Domain Number 2 Region: 409-545
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000216
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 3 Region: 1232-1313
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000851
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 331-437
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000245
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 5 Region: 1406-1513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000259
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 6 Region: 1042-1158
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000144
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 7 Region: 511-641
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000176
Family Spectrin repeat 0.014
Further Details:      
 
Weak hits

Sequence:  FBpp0156203
Domain Number - Region: 2288-2352
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00705
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 2142-2211
Classification Level Classification E-value
Superfamily LemA-like 0.0101
Family LemA-like 0.01
Further Details:      
 
Domain Number - Region: 953-1031
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0791
Family Spectrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0156203   Gene: FBgn0129756   Transcript: FBtr0157711
Sequence length 2369
Comment type=protein; loc=scaffold_15116:complement(1167316..1167338,1170407..1170512,1170591..1170754,1179185..1179293,1179371..1179466,1181695..1181854,1181915..1182076,1182137..1182372,1182459..1183586,1184939..1185026,1186249..1186751,1186812..1187117,1187209..1187490,1188049..1191522,1192986..1193140,1214602..1214719); ID=FBpp0156203; name=DgriGH22297-PA; parent=FBgn0129756,FBtr0157711; dbxref=GB_protein:EDV98611,FlyBase:FBpp0156203,FlyBase_Annotation_IDs:GH22297-PA,REFSEQ:XP_001996250,FlyMine:FBpp0156203; MD5=0dc75dd3b1719052f1930e321aa3f8b7; length=2369; release=r1.3; species=Dgri;
Sequence
MHDPSDYDSVYSEQDFLDIVQGASTPPLMNYEEFLEKTMDERQHIQKKTFTKWINSHLSN
TQCTPVSDLFLDLRDGHRLLALLSTLTHTQLKPEKGRMRVHHINNLNKVMKVIQEHGVKL
VNISSDDIVGGNPKLTLGLIWLIALEFNGQHLVKSHSSNGVEKSLLAWARQYTEPHGLML
NDFANSWADGRAFLMILAAHLDELDLETALAQHALQRLHLAFDLAHRHFKIEKLLDAEDV
HTHKPDNKSIQMYVMCLYHAMESMRANERDRVPCTSITDLDEVPLDAAVDRELYTSDSAA
SMMELKHGVAESASLRPLSTATNASVEISSYQTALEAVLTLLLEDEQLLSQDLPDPENFQ
AAKLQFHENESFMLKLTEHQEFVGEALEEGSNLINESQKKDGSGLSMDDQNEVRQQMVLL
NERWETLRLRALDMQAKILMRLAEFQKQKLEQLRQFLTNVEDRISHMSDLGPTVAEAEQQ
LTEARQLKANLCEQQELVDSISSMVVIVNDTSGNFNDLEDRLSALGERWSHVVKWIDLRT
EKLQQYKCISRWLDAREEDLKRMETRDVTDVGGITQRINELNYCAKDLLELQRYLIDLRQ
MVAATLQDGDDKGERVLMQLESYEDRLDALKQILEVQTRRIETKGFNFGRERASYDDSRV
VRPENWIDYQMIIRFGEDEEKQEHEEHEQEQQQQQKHPKLDAQVDADPLASKKRKLRNAD
NFFALESKIADHFSHVQDVEQQLQQLQRQSLRNQCDLLKELQAENQQRASLLPELKKLYE
VCEQEEPSRKLLLEAAHIKQLEQRYAALGQRLASQHSESSTLLAKERYYNSLIGFKLVLA
DSRDWYKQHAGSASCPELEQRLSHMDSLATEIVEAREATEALDEQLLEWKLDFGLFHDSW
HDMKQALQALIQQRGGESIIRQVQQLEEFVDKVARQKVRVASLDEMQQQQQLLNQLVDEL
ESLKPSYDRVPDHMLSAELQAAWQRLPEQLSERVIKQTTAIENLNHFVAEYNSIIAVLRS
APDIIQAQDLRKLEIDVISARNFSEILIKEAEQPQRDSLQAQIRALNALYEQVEQLYQAQ
RQQQSALQARSEAIQKRLQETERWLCELEANTPKSGVAAIRNSNELFQSKSKFQTLKETC
EREAAQFRELNELGGELLLQMDELPEKGKDKDSKYGTLAKQFTRLNARWTEVTELVYAKT
ALLEHISTQLGEFKKFMVSETGYLDRLENKIRNTPENAADAEEIMEELDDLENVLRAHSD
EWLDKIQEIGNELIDNEFMADVMRQDIDKMVERWTKLQQQAKKRTELLEEKVSEAEQSEK
AVVHLEAWLTRMDEILSEHLENDILAREFAVNEQNFKDITELIAEHTRKGRTGAANRLQE
QLNLMELRFKACQAKLNKCTAPQPAYESRLNRAYGDLRNVEHSTLVLDVASAGPSTVQAQ
YQKCLQIYRTLSEIKAEIESTIKTGRRVCEDKYTKSPKQLSQRIDALKHLYNALGENVTQ
SKVFLEGLLKLARQLEQCFDSADELIRRFESPQELHDRNSILLEFEDVLQRCEEHYNEYS
KSCDQSCMQETRQRIDGLKASYHKLTSADIIKRLTEMKTTLQNLDNISLETLKAMEHDLK
EINVPSNPEIEKLQQQVIAIVVDMLRTRFSATSTLATQDKPRASDDDTEIVVVSDTVRQR
RARTPQSGESSTPSTQTTATTTTTTTRNEANTQKGTASVSVSDSKTKPTSSDGEQVLPDL
LPPQTFRLAESSTLFSQISLNPAKMVAGASAIPPVKPAKNKRKAPAAPAQVVEIKVKNIQ
NDKMSVQNIALAPQQGEIVDTVNILESVEPLLPEYVQTVQIVDLSEDSDSSLLEVRRSKS
KRSLCESPVGSKDPSQETGSDNDGDEAMLRPSAGNTSTPLLRVEKQRISFDEKRKRIAHE
RDILRDSEEDEPPQSGSSVAQSNVAKPKRWRQLQPELQEASSVLLDKQTEPESPIRNSFY
SADKETGFDIEPLVFSDDEEIPRFSLEMTPTFDSDSDTSRIETPSTKKPNSFLSKVLNSM
PSPLDDSNVTLKSPPGELPASANLEQRVQEFNKLSKQMIYKLEVTKAKIEQCHESEAEDL
RMLIAPDAATLISQGDSLVLETHGKQGSISRIVMRTQIILREKFREVQQAKSKVTGTSAP
QATPETVNIEELVTKGLRRINVLIEKPVDLKSSTELEKRMEDINERRDDLQVIVGAIGKN
PQMPKVAPIMMNEIEKTKNNLIAHADSIELSLTQLKNGSQIGNGNGAGSSRQDYNNEPSG
IGALASSFDKSVLHISDWLTWEQNMIKIQSVLVDDVDAVRSDIEAQEKVLRELKMKKPQL
NELVHTAEVLKGDTKRQQLQEKDTFKMVA
Download sequence
Identical sequences B4JYZ6
XP_001996250.1.65300 7222.FBpp0156203 FBpp0156203

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]