SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0156454 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0156454
Domain Number 1 Region: 5-78
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000000314
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0156454   Gene: FBgn0130006   Transcript: FBtr0157962
Sequence length 166
Comment type=protein; loc=scaffold_3173:join(4684..4722,5037..5498); ID=FBpp0156454; name=DgriGH22548-PA; parent=FBgn0130006,FBtr0157962; dbxref=GB_protein:EDW04568,FlyBase:FBpp0156454,FlyBase_Annotation_IDs:GH22548-PA,REFSEQ:XP_001997369,FlyMine:FBpp0156454; MD5=f245c93f070feab5b844b0d2787de790; length=166; release=r1.3; species=Dgri;
Sequence
MTNKTHKHFDYDQTDHQTHQQQGQQQQQQQQQQQQQQQQSSHQQQQQQPQQQLGDGISGD
TLSSLPQASFNYINSIVGSGVIGIPYALHRAGFGLGLALLILVAYITDYSLILMVSVNVY
RMGKRTLNARQIEKRSHNGNGNWMRVSLAESFNLNAFPQIENLIST
Download sequence
Identical sequences B4K265
7222.FBpp0156454 FBpp0156454 XP_001997369.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]