SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0157108 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0157108
Domain Number 1 Region: 76-229
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.32e-39
Family Calponin-homology domain, CH-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0157108   Gene: FBgn0130659   Transcript: FBtr0158616
Sequence length 243
Comment type=protein; loc=scaffold_15074:complement(7296110..7296292,7296361..7296681,7353751..7353978); ID=FBpp0157108; name=DgriGH23202-PA; parent=FBgn0130659,FBtr0158616; dbxref=FlyBase:FBpp0157108,FlyBase_Annotation_IDs:GH23202-PA,GB_protein:EDV95065,REFSEQ:XP_001994329,FlyMine:FBpp0157108; MD5=2cf7f1eec718df5fac1d24f9300ec42d; length=243; release=r1.3; species=Dgri;
Sequence
MITKVINKDHKDHKELEDHRVQQVRSAYSMALARKDNKDHTRAIRRGREVSTDRMVHVDH
MAHSTRVRNPIRTDHKPRNKEQEQEVLNWIFAVIGEKVPSGQYEDILKDGIWLCKLANKL
APGSVKKIQERGTNFQLMENIQRFQAAVKKYGVPEEEIFQTADLFERRNIPQVTLSLYAL
GRITQKHPEFTGPTLGPKMSEKNERTFTEEQLRAHEGELNLQMGFNKGASQSGHGGFSNT
RHM
Download sequence
Identical sequences B4JTH5
FBpp0157108 XP_001994329.1.65300 7222.FBpp0157108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]