SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0158539 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0158539
Domain Number 1 Region: 881-985
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.23e-30
Family Calponin-homology domain, CH-domain 0.0000973
Further Details:      
 
Weak hits

Sequence:  FBpp0158539
Domain Number - Region: 795-850
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00167
Family beta-sandwich domain of Sec23/24 0.028
Further Details:      
 
Domain Number - Region: 86-135
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00602
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0158539   Gene: FBgn0132089   Transcript: FBtr0160047
Sequence length 987
Comment type=protein; loc=scaffold_14853:join(3058193..3058570,3059244..3059384,3060289..3060465,3060528..3061818,3061902..3062047,3062352..3062471,3062537..3062882,3062976..3063250,3063421..3063510); ID=FBpp0158539; name=DgriGH24633-PA; parent=FBgn0132089,FBtr0160047; dbxref=GB_protein:EDV91926,FlyBase:FBpp0158539,FlyBase_Annotation_IDs:GH24633-PA,REFSEQ:XP_001992219,FlyMine:FBpp0158539; MD5=86ef1ea3fdbd44e20a24055def9c7f9c; length=987; release=r1.3; species=Dgri;
Sequence
MTSIAAVPTPATNNSNNNNNSSNSALAALQDGSVAAAAAADFYQQLAAAAATTTNTSATG
NGSSNNSSAAAAAAAVAVAAVAASSYQQQQQQQQQQQQQQQQQQQQEQQQQLQIINNEQQ
QQQLFEANNKMQELHTQLERLGREQLQLETRIVELLPYQSEVTKLKGDLLKMQNQQEKTQ
MEIGNLKYENESLRNRLRDVVNSPLSDAEKHQIIQDSQRLHSSAPASIALPNINESAHDG
TPCLTPDWDKQSSSSEISVACLQDKIIQMEETHYSTNEELQATLQELADLQTQLSDTQTE
NERLSEEKDVLFQSLCRQTEKLNESRTQISTLQELLLRDTKQPAAAAAEVITTEREKKLL
DLIQTSQEEREVFMLKQEELNAELAELRQSRDAVQLEQQRQRERNALLDSQLDAANAERK
QIDAQLAVAKEEISQRAIEISRLSTLLENARSKIEELEADLARGDKTDLSDVLDASRREK
DALEERLAELQDQWSRSQAELRRLREQVAGLSEECKVAKNNAKCAVSHLEYRLEQLQCDK
DKLAGDCQTLEERVAELQVQCKCHQEDKAQLQQLLSETQRHLSDVQLQLSDSESRLDTET
QRRQRDADEWQQFQADLLMTVRVANDFKTEALSAREQLVLDNKLQKDKIRLLEQQLDKLT
KQQLQQTETQQSVLSTVQQEICSRRSKLSFSRQDSRLSVKTLIESIENNKPQGKSDETES
HYSSTSSLNSGTPETGNTPIILPVSGDWHESLRLPVLQSSNLHVNVNNATAAAASTTITT
SATTSTAANTTKAIQQQQQQHQQLQLQQQLSQQSTTSATSTPPSTPNTPSSLQQQQPSLS
TPSTQTPNSSALVTSLSFGNVSKSYSGERKDPLNMLAKNGGSKRNALLKWCQNKTVGYRN
IDITNFSSSWNDGLAFCAILHSYLPDCIPYDTLSPANKWRNFSLAFAAAESVGINTTLNI
NDMCQIERPDWTQVMSYVTAIYKYFET
Download sequence
Identical sequences B4JMI3
XP_001992219.1.65300 FBpp0158539 7222.FBpp0158539

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]