SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0158616 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0158616
Domain Number 1 Region: 266-340
Classification Level Classification E-value
Superfamily GAS2 domain-like 6.54e-26
Family GAS2 domain 0.00015
Further Details:      
 
Domain Number 2 Region: 12-63,95-173
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.65e-25
Family Calponin-homology domain, CH-domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0158616   Gene: FBgn0132165   Transcript: FBtr0160124
Sequence length 993
Comment type=protein; loc=scaffold_14853:join(4961664..4961831,4980823..4981019,4981443..4981561,4981674..4981999,4985881..4985988,4986116..4986306,4987572..4988158,4988805..4990090); ID=FBpp0158616; name=DgriGH24710-PA; parent=FBgn0132165,FBtr0160124; dbxref=GB_protein:EDV92073,FlyBase:FBpp0158616,FlyBase_Annotation_IDs:GH24710-PA,REFSEQ:XP_001992366,FlyMine:FBpp0158616; MD5=84a8a9bcc39fcae09e5a59f75b928c3a; length=993; release=r1.3; species=Dgri;
Sequence
MAMLEARPYRPFKSSEEYLEAMKEDLAEWLSMLYPELSINAENFMDRLDTGVALCKHANY
VRQAAEDYLARRQARNKSMTRSMTSGLAGPILALGNVHYLPAAKSGTFFARDNVSNFITW
CRKSLKIIECLLFETDDLIMRKNEKHVILCLLEVARRGAKFGMLAPMLVQMERQIDREIA
ADNKANGCSCACGCGNGCNTNGCGTQTGNGCSESGTQTEPPTVGAERVAVETDLYDSDTE
NEDENDKDPMLMYGPQPQIITNDLKSLDEMVRDLVEKCTCPSQFPMVRVSEGKYRIGDTK
VLIFVRILRSHVMVRVGGGWDTLSHYLDKHDPCRCRAQHRSSIQARLMTRNTTNSGNGIE
LHKAHVIYERSPPAARRIMSAGSGNGSASGSGATSPAAGGVQTTSNVKHRSRSPTPQRKY
LNQTNNNALANANANANASSCNMDLVTGSPMLSRRSMSPSQRRLIDMRKKQSSLDTYHRD
GPKSLPLAPAAGDSCEEATTGATGASATIANGAQQPEQSSKFENISDNGSEISDEGYRSL
GVIQSNAQKRESLHSQASMEDAETNARLDQTSSDSQISPTDEPEPEPARVVLEVETKDEP
DYAICDAIDGPQSLPAVLSLPKPRGVAAGYAEEGHSSKFEQSGVYIDDDEITVTTDVDVD
VDVDVDVDVNGATNVNSGNNLVATATNQPQSQGSKIPRSPLAQRRRRRSSSIDNATCAGG
SLQDLSTRPPPPQNGVFSRKQPVYRSVRRPAPVAVPVLVPSPSPSPGPATVKASQLPLVR
DVTNTWGGRSAATPTVANKKRPTINADTFAPPLAAATSPAPFERGSKTRSSHILYDSNGR
RVRGCTSSLTTSPVKNHASSPLAQQLLEAASSAKNDAQILEKMKTLLSRYAAGNQQQQQQ
QQQQPRPSPSNCNGKKTPVYEDFTTAWVHSNGNLERSESCSPPAKARSKRSSGASSCGSN
NSAGAATAAMVSPRRERGMSKIPAPVRHHTELY
Download sequence
Identical sequences B4JMY0
XP_001992366.1.65300 7222.FBpp0158616 FBpp0158616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]