SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0145098 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0145098
Domain Number 1 Region: 38-307
Classification Level Classification E-value
Superfamily L domain-like 5.78e-50
Family Ngr ectodomain-like 0.0045
Further Details:      
 
Domain Number 2 Region: 224-545
Classification Level Classification E-value
Superfamily L domain-like 5.1e-49
Family Ngr ectodomain-like 0.014
Further Details:      
 
Domain Number 3 Region: 918-1060
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-42
Family Toll/Interleukin receptor TIR domain 0.0000725
Further Details:      
 
Domain Number 4 Region: 644-786
Classification Level Classification E-value
Superfamily L domain-like 5.92e-30
Family Ngr ectodomain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0145098   Gene: FBgn0118673   Transcript: FBtr0146606
Sequence length 1247
Comment type=protein; loc=scaffold_9518:join(2197..2295,2348..3993,4034..6032); ID=FBpp0145098; name=DgriGH11192-PA; parent=FBgn0118673,FBtr0146606; dbxref=GB_protein:EDW05174,FlyBase:FBpp0145098,FlyBase_Annotation_IDs:GH11192-PA,REFSEQ:XP_001997003,FlyMine:FBpp0145098; MD5=653f6b4acbdbcf14806dbc33362a9143; length=1247; release=r1.3; species=Dgri;
Sequence
MSLEMASNSFVEFRQLERLDLSLNNIWLIPDGMDISNFYFSSASLTSSRKSRICGSTLES
LDLSANKMVSLPSAMLSALVRLTHLNMAKNSMSFLADRAFEGLASLRVVDLSANRLTSLP
PELFAETKHLQEIYLRNNSINVLAPGIFGELAELLVLDLASNELNSQWINAATFVGLKQL
MMLDLSANKISRLEAHIFRPLASLQILKLEENYIDQLPAGIFADLGELHTLILSNNRISV
VEQRTLQGLHSLQVLSLDYNRLSKLDPRSLLNCSQLQDLHLNDNKLLAVPEALAHVPLLK
TLDVGENMISQIENTSITQLENLYGLRMTENSLTHIRRGVFDRMSSLQILNLSGNKLKSI
EAGALQRNTQLQAIRLDGNQLKSIAGLFMELPNLVWLNISGNRLEKFDYSHIPIGLQWLD
VRANRITQLGNYFEIENELSLSTFDASYNLLTEITASSIPNSVEVLYLNDNLIAKIQPYT
FFKKPNLTRVDLVRNKLTTLEPNALRLSPIGEDREIPEFYIGHNAYECDCNLDWLQKINR
ESRTQPQLMDLDQIHCKLSYARGSTHVSLIEAKSNDFLCKYEPAIVKWNAPIVVPVITDQ
SWTSNVVDCSRASYDRSLLPSHIPMDATQLYLDGNTFAELQSHAFIGRKRLKVLHLNHSR
IETLHNRTFYGLLELEVLQLQNNLLRALNGNEFQGLDNLQELYLQHNAIATIDTLTFTHL
YHLKILRLDHNAIGSFAVWNFLPSYLNELRLAGNPWSCRCEFIDKLRDFMSRHEYVLDRQ
KLHCEMPSNSTQQQQQQPVQMAIYGATGDSLPVVQCSQMLQLGLDNNFNYAERGAAGGND
ANGDAMLNGNMTSTKMILTQPPKQDYIPILVAILTAFIFIMICTLLVFIFRQEMRVWCHA
RFGVRLFYNGQKDVDKNEREKLFDAFISYSSKDELFVNEELAPMLELGEQRYKLCLHQRD
FPIGGYLPETIVQAIDSSRRTIMVVSENFIKSEWCRFEFKSAHQSVLRDRRRRLIVIVLG
EVPQKELDPDLRLYLKTNTYLQWGDKLFWQKLRFALPDVSASSAASAAAAAAASSHVQRS
GQSCHAAMNHPAYHHHHHHHVQQQPLPLPLPLPLHGGHPVQHPHPHHHLQQQQQQQQQPQ
FMLPPPPTLQPGSFRRQPSTQQSHRPNATSNNNNSSNNCNNPQQQAALLMGGASGASVGG
GGAGNLIAGGAQPQMIPLAGGIQQQSLPLPPQVTSTQPTPASRNLHM
Download sequence
Identical sequences B4K149
XP_001997003.1.65300 FBpp0145098 7222.FBpp0145098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]