SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0145180 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0145180
Domain Number 1 Region: 68-121,263-321
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000419
Family Second domain of FERM 0.0055
Further Details:      
 
Weak hits

Sequence:  FBpp0145180
Domain Number - Region: 6-67
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00155
Family First domain of FERM 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0145180   Gene: FBgn0118754   Transcript: FBtr0146688
Sequence length 357
Comment type=protein; loc=scaffold_15062:1963..3036; ID=FBpp0145180; name=DgriGH11274-PA; parent=FBgn0118754,FBtr0146688; dbxref=GB_protein:EDV94281,FlyBase:FBpp0145180,FlyBase_Annotation_IDs:GH11274-PA,REFSEQ:XP_001996899,FlyMine:FBpp0145180; MD5=1c1cf1acfaabd3c4fc70040d4d1dc091; length=357; release=r1.3; species=Dgri;
Sequence
MNLSLKVCKALGIICEMEYFGLEPWTPNQKESRTRQWYNLRNRLHGDSGSSSNSIQLMLA
LRVKFWVPVHNILQESVLNLFYMQARRDLLEARLCAQDWTNAAKLAALLCQADGHRFNEQ
SLRAECPMRMRRELAQQQQLALQQQQQQQHKLEQQRKEKEHVLSFKKRRLSKQKSVEHMD
CCTLSAAAAAAAAATATTAAAAAASTAAATTAAAATLANSNQNLQPSPSASVSVSASTSA
STSSSPSNSSSSHSGLDQRLASNPLRIYEDYIIQPSVKETEPPVDFLRQIANEHSKLAKL
RMSVKSAKYWLLQEIQELSGYGEEIFSGVSTNESATRCEIAVGAHGITVVRGEEKER
Download sequence
Identical sequences B4K0U5
XP_001996899.1.65300 7222.FBpp0145180 FBpp0145180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]