SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0146776 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0146776
Domain Number 1 Region: 98-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 6.67e-31
Family NodB-like polysaccharide deacetylase 0.026
Further Details:      
 
Domain Number 2 Region: 28-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 4.18e-16
Family Tachycitin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0146776   Gene: FBgn0120349   Transcript: FBtr0148284
Sequence length 490
Comment type=protein; loc=scaffold_15203:join(10928317..10928368,10936000..10936091,10936185..10936296,10943321..10943448,10950016..10950158,10962391..10962610,10963577..10963962,10967416..10967755); ID=FBpp0146776; name=DgriGH12870-PA; parent=FBgn0120349,FBtr0148284; dbxref=FlyBase:FBpp0146776,FlyBase_Annotation_IDs:GH12870-PA,GB_protein:EDW00442,REFSEQ:XP_001991817,FlyMine:FBpp0146776; MD5=9e21d9edb7884d00b1e46a874f129dd9; length=490; release=r1.3; species=Dgri;
Sequence
MLQQCLIAALLIAACVRAQSKDKEEFTCPSHIANGNYADPATCRRFYQCVDGYPYLNRCP
SGLYFDDLQKFCTFKDEAKCGPLPTTPAPATDAPADTAQRCNTEECQLPYCFCSKDGTQV
PGELEAEKIPQIIMLTFDGAVNLNNYDHYQKIFNGKRQNPNGCKIRGTFFLSHEYSNYQQ
IQHLGYAGHEIATESISQQLGLQDKGYEEWVGEMIGMREILRHFSNVSVNDVVGMRAPFL
KPGRNTQYKVLEDFGYIYDSSITVPPVPVPVWPYTLDFKISHECKSGTCPSRTFPGVWEV
PLNTHYVEGFEGGHCPYMDQCVLHNLDENEVLEWLQEDFSRYYEQNKAPYMMPFHTNWFQ
TKPLENGLHKFLDWALELPDVYILTVTQMLQYMTDPKELRDVNQIESWKCDKNIAVAPKP
CNIWQTCALSFKIPEQNLTDTRYMETCRECPNVYPWLGDAGGTGISGRDNYIYSGAGGDA
PDEPEAANRE
Download sequence
Identical sequences B4JLI9
7222.FBpp0146776 XP_001991817.1.65300 FBpp0146776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]