SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0151867 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0151867
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.01e-40
Family G proteins 0.0000258
Further Details:      
 
Domain Number 2 Region: 191-230
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000144
Family SOCS box-like 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0151867   Gene: FBgn0125429   Transcript: FBtr0153375
Sequence length 262
Comment type=protein; loc=scaffold_15081:join(3752128..3752251,3752319..3752542,3752613..3752835,3752912..3753129); ID=FBpp0151867; name=DgriGH17961-PA; parent=FBgn0125429,FBtr0153375; dbxref=GB_protein:EDV95459,FlyBase:FBpp0151867,FlyBase_Annotation_IDs:GH17961-PA,REFSEQ:XP_001995807,FlyMine:FBpp0151867; MD5=8baf37eee32a37259e67a2e0437e3dba; length=262; release=r1.3; species=Dgri;
Sequence
MTKDYDYLLKVLLVGDSDVGKHEILSNLEDPSTENPFCSGNDCTSHILQTVAYKTTTILL
EGKRVKLQIWDTSGQGRFCTIIRSYSRGAQGIILVYDITNKWSFDGIDRWLKEVEEHAPG
IPKVLVGNRLHLAYKRQVAAKQAETYASRNNMSCFEISPLCDFNIRESFCELARMALHRN
GMEHIWRSNKVLSLQELCCRTIVRRTSVYAIDSLHLPPSVKSTLKSYAMTTTQCYNSLTQ
NSKSRNRCKTPTSNSRNSCAIA
Download sequence
Identical sequences B4JXI3
FBpp0151867 7222.FBpp0151867 XP_001995807.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]