SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0153140 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0153140
Domain Number 1 Region: 549-810
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-79
Family Protein kinases, catalytic subunit 0.0000184
Further Details:      
 
Domain Number 2 Region: 408-522
Classification Level Classification E-value
Superfamily PH domain-like 6.47e-25
Family Pleckstrin-homology domain (PH domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 80-156
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.09e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00095
Further Details:      
 
Domain Number 4 Region: 219-277
Classification Level Classification E-value
Superfamily Cysteine-rich domain 5.53e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0153140   Gene: FBgn0126700   Transcript: FBtr0154648
Sequence length 839
Comment type=protein; loc=scaffold_14906:join(7269274..7269399,7270589..7270733,7270894..7271031,7271171..7271355,7272029..7273019,7273448..7274185,7274243..7274439); ID=FBpp0153140; name=DgriGH19234-PA; parent=FBgn0126700,FBtr0154648; dbxref=FlyBase:FBpp0153140,FlyBase_Annotation_IDs:GH19234-PA,GB_protein:EDV93310,REFSEQ:XP_001990248,FlyMine:FBpp0153140; MD5=d751144247eec9e5f6d1f56c4fd099b2; length=839; release=r1.3; species=Dgri;
Sequence
MEGPEVTFLFQFGSIRDAVCVPANALTLKSLKDLACDFINTKIPDSGLTYLSERILLFIH
DYSTPNVLHIINSAAEVVDETLVEIVLTASPILYPTSEMPTLMPHTLNVHSYKAPTFCDF
CGEMLFGLVRQGLKCDGCGQNYHKRCVVKIPNNCNRSSDATSRRSFTLHPPRSPSGSSQQ
SLISNEESTGRHDSSSSLNIPGFGARHQRTHSSGSRNGLSVLRIPHTFMVHTYGIPTVCQ
LCKKLLKGLFKQGLQCRDCQYNTHKKCMDKVPQDCTGEAQLSQLQAEINDGTPRKERDNF
FREEFDDSDFEDGPPQEFAKYNRASSGTNLVAGRPREAPKALTNAQNSPPELVNGVRDDS
STGGDTKSNDGQSEQSQSSSSSSPSANIPLMRIVQSVKHTKKRGGQALKEGWLVHYTSLD
KALKRYYWRMDSKTITLFISEQGSKYHKEIPLAELLSIETHRDPRPDSNYCFELCTANLS
YYVGQDPQQGVGDDHAVRRPPPDSGIGADIAKSWETSIRQAYMHVTNTQCCESEEQVQDM
GQLYQIFPDEVLGSGQFGVVYGGVHKKTKREVAIKVIDKLRFPTKQEAQLKNEVAILQNI
THCGVVNLERMFETPERIFVVMEKLKGDMLEMILSHSRGRLSERVTKFLITQILIALKYL
HSQNIVHCDLKPENVLLSSDAEFPQVKLCDFGYARIIGEKSFRRSVVGTPAYLAPEVLRN
KGYNRSLDMWSVGVIIYVSLSGTFPFNEEEDINDQIQNAAFMYPPNPWKEISSNAIDLIN
NLLQVKQRKRYTCDKSLMHYWLQDKQTYRDLRNLETQVGLGRYLTHEADDVRWDSASDI
Download sequence
Identical sequences B4JF29
FBpp0153140 XP_001990248.1.65300 7222.FBpp0153140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]