SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0153483 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0153483
Domain Number 1 Region: 503-632
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-18
Family Second domain of FERM 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0153483   Gene: FBgn0127041   Transcript: FBtr0154991
Sequence length 801
Comment type=protein; loc=scaffold_14906:join(13542523..13542881,13542958..13543637,13543710..13543870,13544365..13544711,13544767..13544928,13544985..13545173,13545858..13545987,13546486..13546584,13546665..13546815,13546936..13547063); ID=FBpp0153483; name=DgriGH19577-PA; parent=FBgn0127041,FBtr0154991; dbxref=GB_protein:EDV93886,FlyBase:FBpp0153483,FlyBase_Annotation_IDs:GH19577-PA,REFSEQ:XP_001990824,FlyMine:FBpp0153483; MD5=2da2593917ddae3d6b76e675ebe71962; length=801; release=r1.3; species=Dgri;
Sequence
MEANQYYCRNEMQQNSSPSISQPPLSKMNYVNNGGQEYVACSSNHSESGYNSSDMPPRNG
NNKAVIGNRSMGNPYAFPSCNNSSHCTNNTNNTGNYINIMSVPLSTLQYNRKKSTSQDYQ
SRLYYNTTDVKCRDDYYLGNNVKRSNETTAQIQHHQIQQHQTSQNHHHVQHQLQHINQNA
HSQRMQNQNQQKTACSPNSALDTIDVDCTMYSNAANAGSGGRVGAATQTHLSNANVASCD
QLGSHQTPVSLVPVNVPVPPVMYTVHRVVTTAQIQTAVGSTFASSASVSSVVSAGRNEND
CISSAQVTSAMSISAKDPCLHLSELSGNIINTGNSLGPLTGVRSASGILQNLLPVQQKCN
SSSEAQQNPVVTKRIVAGNSSSTYTSAGKPNSIVTRTLQNVIPTCVYLMSRVAVHMEIEG
TVQCPSQVMLAAALGCEELGISNKLLAQSIFGLWMTSSLLEMQLKAHHCPYIVRVAWPNL
LEKFSSGTPIERKYDEPMIVLKRNVFFSKRDEEKIKDHRIVELLYEEAKHYVLTGRYIME
PVHSLMLGGIQARIELGPYNSHTHTVGFFRENQSRFLPKHVAKSSNWLWLPISKKNSAEI
KLLEQFKRVPQTATTRKLMRKYLEFCWALPFYGAAFFHGQMEQPVRGIMSLVNHKDMEVL
LAVNERGIFIIDCVENTLLLGLRYEDMSWDYAKPSDSEDSECLTCIFLQFDAVENGIQIS
KLVQVFSKQAAMIDALISHFTEQMRKKRQEGNSAEQFHDEPNPIQNNGNGILCNKLSRLT
LASFDEEGRCIGQMGSLSISY
Download sequence
Identical sequences B4JHP7
FBpp0153483 XP_001990824.1.65300 7222.FBpp0153483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]