SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0153863 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0153863
Domain Number 1 Region: 92-149
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000327
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0153863   Gene: FBgn0127421   Transcript: FBtr0155371
Sequence length 221
Comment type=protein; loc=scaffold_15245:complement(15149626..15150015,15150071..15150298,15150427..15150474); ID=FBpp0153863; name=DgriGH19957-PA; parent=FBgn0127421,FBtr0155371; dbxref=GB_protein:EDW02319,FlyBase:FBpp0153863,FlyBase_Annotation_IDs:GH19957-PA,REFSEQ:XP_001987452,FlyMine:FBpp0153863; MD5=fa4d4fbdf18a580a010705c762706e38; length=221; release=r1.3; species=Dgri;
Sequence
MISKSQQLLLVIGLCLSVASSADVDCTERPKFVNPTKCCPIHEFISVEVKEKCQQYNVTP
SEQPPMSDEQSGEGRHRHHHHHHHHPRIFQQQCLVSCIFNETGFYEDNKLDETKLDDYLK
LTIPDDVQLQTVTKEAFISCAAKAKEFKDKFGNRPRPSPPPSQSMCPRKPAFLTGCVYFN
LLQNCPPTIWNNSAECSENREFFKNCKSPRRRPSSEDKSAA
Download sequence
Identical sequences B4J8G0
XP_001987452.1.65300 FBpp0153863 7222.FBpp0153863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]