SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0155527 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0155527
Domain Number 1 Region: 9-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.19e-43
Family Calponin-homology domain, CH-domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0155527   Gene: FBgn0129082   Transcript: FBtr0157035
Sequence length 184
Comment type=protein; loc=scaffold_15245:join(10622432..10622461,10622596..10622928,10622999..10623190); ID=FBpp0155527; name=DgriGH21621-PA; parent=FBgn0129082,FBtr0157035; dbxref=FlyBase:FBpp0155527,FlyBase_Annotation_IDs:GH21621-PA,GB_protein:EDW01761,REFSEQ:XP_001986894,FlyMine:FBpp0155527; MD5=709f7b5cfaffb26aa318280ec8d9d5ea; length=184; release=r1.3; species=Dgri;
Sequence
MSLERAVRAKIAGKRNPEMDKEAQEWIEAILGEKFPAGQVYEDVLKDGQVLCTLMNKLSP
DSVLKINSSGGQFKFMENLNNFQKALKAYGVPDIDVFQTVDLYEKKDIANVTNTIFALGR
ATYKHAEFKGPFLGPKPADECKRDFSEEQLKAGQTIVGLQAGSNKGATQAGQNIGAGRKI
LLGK
Download sequence
Identical sequences B4J5B9
7222.FBpp0155527 FBpp0155527 XP_001986894.1.65300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]