SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0155590 from Drosophila grimshawi 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0155590
Domain Number 1 Region: 440-738
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-78
Family Protein kinases, catalytic subunit 0.000000047
Further Details:      
 
Domain Number 2 Region: 938-1071
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 4.71e-49
Family FAT domain of focal adhesion kinase 0.0000451
Further Details:      
 
Domain Number 3 Region: 149-265
Classification Level Classification E-value
Superfamily Second domain of FERM 1.33e-33
Family Second domain of FERM 0.00019
Further Details:      
 
Domain Number 4 Region: 269-391
Classification Level Classification E-value
Superfamily PH domain-like 6.27e-25
Family Third domain of FERM 0.00096
Further Details:      
 
Domain Number 5 Region: 21-99,129-145
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000017
Family First domain of FERM 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0155590   Gene: FBgn0129145   Transcript: FBtr0157098
Sequence length 1189
Comment type=protein; loc=scaffold_15245:join(11681544..11681595,11681669..11681856,11681911..11682165,11682222..11682496,11682561..11682670,11682736..11682953,11683020..11683251,11683322..11683558,11683620..11683752,11683812..11683944,11684004..11684067,11684129..11684209,11684277..11684481,11684545..11684684,11684750..11684898,11685941..11686030,11686093..11686538,11686605..11686715,11686786..11687236); ID=FBpp0155590; name=DgriGH21684-PA; parent=FBgn0129145,FBtr0157098; dbxref=GB_protein:EDW01885,FlyBase:FBpp0155590,FlyBase_Annotation_IDs:GH21684-PA,REFSEQ:XP_001987018,FlyMine:FBpp0155590; MD5=15d04183b9c4c848fd95fc51fc0c9eff; length=1189; release=r1.3; species=Dgri;
Sequence
MNTAEGNQSNQPHKSNESHSEDYVLHVHMPNKSFKSIAFNKNETVFHIIKKTVEEFGKDG
QPPPSIQRYACRMLNVITKEVLWLARTTLMDKVLSHILSPGCSNIDCPNNDPIKANLTEC
KGTHQGRRSVTTGVWRVELRVRYVPHRIQDLFDEDKTTCFYYFDQVKDDYIQANLTAVDA
DLAVQLCCLGIRHYFKNITLKAPDKKQHIDYIEKEIGFKCFIPQSVISTTKPKNLKKMIQ
VGYKKVYNYNDIEYLTKFFHLLKNFFLTDFEQFSVTLSSAWNISGILHVGPHIGISYQTH
PQASLRNVAQFKDVVAIKTCALPKEKLLIEAEQQNLNCNCQKIKTQIKISASNIAEPLII
TCNGVNTAESIADLIDGYCRLLTKDLGFTIWQRESSVNTADSSTKTSNDQPTTSSPSKSK
PMLTDDYAEIGLLEGEGDYSTPTVRNYELDRSQIVLSAKIGVGQFGDVYVGSYTIPISAK
KIKANESDQSNSDAKYDVIQVAVKTCKANDDPEKTENFLAEAYIMQKFDHPHIIRLIGIC
SIMPIWIVMELAKLGELRAYLKTNSERLTHGVLLKYCYQLATALSYLESKKFVHRDIAAR
NVLVSTPTCVKLADFGLSRWVSDQSYYHSTPTVALPIKWMSPESINFRRFTTASDVWMFG
VCIWEILMLGVKPFQGVKNSDVITKLENGERLPLPLNCPPRLYSLMSQCWAYEPLKRPNF
KRIKETLFEILLEDSISSSETMRREHRRVAGISWLGDADNDIPPLKPSRTVNDTDMPSLM
NVNEENRTVPQTYIIAQNPAVLARLMMENQKRGINPAAYTTPASSIPQPISEKLWQQRKD
SNSDGEWLYQEELVRKRSSPTPADVMLKHQSFKSDSILGGPTSLPDCSSANTRPKIPNPN
VYPLKLNNSSSDYLMSSLATTEDTAKSRNSENQDGIRPVNRANDEVYCATTAVVKSIMVL
SQGVEKSHVDGYLSLVKNVGVELRNLLKSVDNISILFPPQALKEVEMAHKVLSKDMHELV
SAMHLAHQYNDTTLDNEYRKSMLSAAHILAMDAKNLFDVVDSIRNRYQSFSTKNVKKLAR
KESSGSLICESVQLASDIAIADEPVNTIGCSVADISLYDNENLQQGFNTQHLQTAHSSGI
VGDGITQSSLHRPNDISHESNEPLKIIEDTLNNAAEHMYCNTSALHGHA
Download sequence
Identical sequences B4J627
XP_001987018.1.65300 7222.FBpp0155590 FBpp0155590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]